TAF8

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF8
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF8, 43, II, TAF, TAFII-43, TAFII43, TBN, TATA-box binding protein associated factor 8, TAF(II)43
Зовнішні ІД OMIM: 609514 MGI: 1926879 HomoloGene: 11094 GeneCards: TAF8
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_138572
NM_022015
NM_001356290
RefSeq (білок)
NP_612639
NP_071298
NP_001343219
Локус (UCSC) Хр. 6: 42.05 – 42.09 Mb Хр. 17: 47.48 – 47.5 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF8 (англ. TATA-box binding protein associated factor 8) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 310 амінокислот, а молекулярна маса — 34 262[4].

Послідовність амінокислот
1020304050
MADAAATAGAGGSGTRSGSKQSTNPADNYHLARRRTLQVVVSSLLTEAGF
ESAEKASVETLTEMLQSYISEIGRSAKSYCEHTARTQPTLSDIVVTLVEM
GFNVDTLPAYAKRSQRMVITAPPVTNQPVTPKALTAGQNRPHPPHIPSHF
PEFPDPHTYIKTPTYREPVSDYQVLREKAASQRRDVERALTRFMAKTGET
QSLFKDDVSTFPLIAARPFTIPYLTALLPSELEMQQMEETDSSEQDEQTD
TENLALHISMEDSGAEKENTSVLQQNPSLSGSRNGEENIIDNPYLRPVKK
PKIRRKKSLS

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, ацетилювання, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Guermah M., Ge K., Chiang C.-M., Roeder R.G. (2003). The TBN protein, which is essential for early embryonic mouse development, is an inducible TAFII implicated in adipogenesis.. Mol. Cell 12: 991 — 1001.  PubMed DOI:10.1016/S1097-2765(03)00396-4
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17300 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q7Z7C8 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]