NFYB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFYB
Protein NFYB PDB 1n1j.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFYB, CBF-A, CBF-B, HAP3, NF-YB, nuclear transcription factor Y subunit beta
Зовнішні ІД OMIM: 189904 MGI: 97317 HomoloGene: 38149 GeneCards: NFYB
Шаблон експресії
PBB GE NFYB 218128 at fs.png

PBB GE NFYB 218127 at fs.png

PBB GE NFYB 218129 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006166
NM_010914
RefSeq (білок)
NP_006157
NP_006157.1
NP_035044
Локус (UCSC) Хр. 12: 104.12 – 104.14 Mb Хр. 10: 82.75 – 82.76 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFYB (англ. Nuclear transcription factor Y subunit beta) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 207 амінокислот, а молекулярна маса — 22 831[4].

Послідовність амінокислот
1020304050
MTMDGDSSTTDASQLGISADYIGGSHYVIQPHDDTEDSMNDHEDTNGSKE
SFREQDIYLPIANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSE
ASERCHQEKRKTINGEDILFAMSTLGFDSYVEPLKLYLQKFREAMKGEKG
IGGAVTATDGLSEELTEEAFTNQLPAGLITTDGQQQNVMVYTTSYQQISG
VQQIQFS

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Chattopadhyay C., Hawke D., Kobayashi R., Maity S.N. (2004). Human p32, interacts with B subunit of the CCAAT-binding factor, CBF/NF-Y, and inhibits CBF-mediated transcription activation in vitro.. Nucleic Acids Res. 32: 3632 — 3641.  PubMed DOI:10.1093/nar/gkh692
  • Romier C., Cocchiarella F., Mantovani R., Moras D. (2003). The NF-YB/NF-YC structure gives insight into DNA binding and transcription regulation by CCAAT factor NF-Y.. J. Biol. Chem. 278: 1336 — 1345.  PubMed DOI:10.1074/jbc.M209635200
  • Li X.-Y., Hooft van Huijsduijnen R., Mantovani R., Benoist C.O., Mathis D. (1992). Intron-exon organization of the NF-Y genes. Tissue-specific splicing modifies an activation domain.. J. Biol. Chem. 267: 8984 — 8990.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7805 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P25208 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]