PBX2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PBX2
HoxB1-Pbx1 heterodimer binding DNA 1b72.png
Ідентифікатори
Символи PBX2, G17, HOX12, PBX2MHC, PBX homeobox 2
Зовнішні ІД OMIM: 176311 MGI: 1341793 HomoloGene: 48115 GeneCards: PBX2
Пов'язані генетичні захворювання
бронхіальна астма[1]
Шаблон експресії
PBB GE PBX2 202876 s at fs.png

PBB GE PBX2 202875 s at fs.png

PBB GE PBX2 211096 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002586
NM_017463
RefSeq (білок)
NP_002577
NP_059491
Локус (UCSC) Хр. 6: 32.18 – 32.19 Mb Хр. 17: 34.59 – 34.6 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PBX2 (англ. PBX homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 430 амінокислот, а молекулярна маса — 45 881[5].

Послідовність амінокислот
1020304050
MDERLLGPPPPGGGRGGLGLVSGEPGGPGEPPGGGDPGGGSGGVPGGRGK
QDIGDILQQIMTITDQSLDEAQAKKHALNCHRMKPALFSVLCEIKEKTGL
SIRSSQEEEPVDPQLMRLDNMLLAEGVAGPEKGGGSAAAAAAAAASGGGV
SPDNSIEHSDYRSKLAQIRHIYHSELEKYEQACNEFTTHVMNLLREQSRT
RPVAPKEMERMVSIIHRKFSAIQMQLKQSTCEAVMILRSRFLDARRKRRN
FSKQATEVLNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRI
RYKKNIGKFQEEANIYAVKTAVSVTQGGHSRTSSPTPPSSAGSGGSFNLS
GSGDMFLGMPGLNGDSYSASQVESLRHSMGPGGYGDNLGGGQMYSPREMR
ANGSWQEAVTPSSVTSPTEGPGSVHSDTSN

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Monica K., Galili N., Nourse J., Saltman D., Cleary M.L. (1991). PBX2 and PBX3, new homeobox genes with extensive homology to the human proto-oncogene PBX1.. Mol. Cell. Biol. 11: 6149 — 6157.  PubMed DOI:10.1128/MCB.11.12.6149
  • Aguado B., Campbell R.D. (1995). The novel gene G17, located in the human major histocompatibility complex, encodes PBX2, a homeodomain-containing protein.. Genomics 25: 650 — 659.  PubMed DOI:10.1016/0888-7543(95)80007-9
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lu Q., Wright D.D., Kamps M.P. (1994). Fusion with E2A converts the Pbx1 homeodomain protein into a constitutive transcriptional activator in human leukemias carrying the t(1;19) translocation.. Mol. Cell. Biol. 14: 3938 — 3948.  PubMed DOI:10.1128/MCB.14.6.3938

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]