ATF6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ATF6
Ідентифікатори
Символи ATF6, ATF6A, ACHM7, activating transcription factor 6
Зовнішні ІД OMIM: 605537 MGI: 1926157 HomoloGene: 32015 GeneCards: ATF6
Пов'язані генетичні захворювання
хвороба Паркінсона, achromatopsia 7[1]
Шаблон експресії
PBB GE ATF6 203952 at fs.png

PBB GE ATF6 217550 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_007348
NM_001081304
RefSeq (білок)
NP_031374
NP_001074773
Локус (UCSC) Хр. 1: 161.77 – 161.96 Mb Хр. 1: 170.7 – 170.87 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ATF6 (англ. Activating transcription factor 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 670 амінокислот, а молекулярна маса — 74 585[5].

Послідовність амінокислот
1020304050
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAAN
ETYENNFDNLDFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSY
SVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKE
DKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTNSSVPA
KTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLP
SAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV
GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKK
ENGTLKRQLDEVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQ
DSRRMNPSVSPANQRRHLLGFSAKEAQDTSDGIIQKNSYRYDHSVSNDKA
LMVLTEEPLLYIPPPPCQPLINTTESLRLNHELRGWVHRHEVERTKSRRM
TNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGSELQVYYASPR
SYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAINI
NENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFG
SPPAATEATHVVSTIPESLQ

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, відповідь на порушення конформації білку, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, мембрані, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Zhu C., Johansen F.E., Prywes R. (1997). Interaction of ATF6 and serum response factor.. Mol. Cell. Biol. 17: 4957 — 4966.  PubMed DOI:10.1128/MCB.17.9.4957
  • Yoshida H., Haze K., Yanagi H., Yura T., Mori K. (1998). Identification of the cis-acting endoplasmic reticulum stress response element responsible for transcriptional induction of mammalian glucose-regulated proteins; involvement of basic-leucine zipper transcription factors.. J. Biol. Chem. 273: 33741 — 33749.  PubMed DOI:10.1074/jbc.273.50.33741
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hai T., Liu F., Coukos W.J., Green M.R. (1989). Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.. Genes Dev. 3: 2083 — 2090.  PubMed DOI:10.1101/gad.3.12b.2083
  • Haze K., Yoshida H., Yanagi H., Yura T., Mori K. (1999). Mammalian transcription factor ATF6 is synthesized as a transmembrane protein and activated by proteolysis in response to endoplasmic reticulum stress.. Mol. Biol. Cell 10: 3787 — 3799.  PubMed DOI:10.1091/mbc.10.11.3787
  • Yoshida H., Matsui T., Yamamoto A., Okada T., Mori K. (2001). XBP1 mRNA is induced by ATF6 and spliced by IRE1 in response to ER stress to produce a highly active transcription factor.. Cell 107: 881 — 891.  PubMed DOI:10.1016/S0092-8674(01)00611-0

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]