HIC1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HIC1
Ідентифікатори
Символи HIC1, ZBTB29, ZNF901, hic-1, hypermethylated in cancer 1, HIC ZBTB transcriptional repressor 1
Зовнішні ІД OMIM: 603825 MGI: 1338010 HomoloGene: 4740 GeneCards: HIC1
Шаблон експресії
PBB GE HIC1 208461 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006497
NM_001098202
NM_001098203
NM_010430
RefSeq (білок)
NP_001091672
NP_006488
NP_001091673
NP_034560
Локус (UCSC) Хр. 17: 2.05 – 2.06 Mb Хр. 11: 75.16 – 75.17 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HIC1 (англ. HIC ZBTB transcriptional repressor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 733 амінокислот, а молекулярна маса — 76 508[4].

Послідовність амінокислот
1020304050
MTFPEADILLKSGECAGQTMLDTMEAPGHSRQLLLQLNNQRTKGFLCDVI
IVVQNALFRAHKNVLAASSAYLKSLVVHDNLLNLDHDMVSPAVFRLVLDF
IYTGRLADGAEAAAAAAVAPGAEPSLGAVLAAASYLQIPDLVALCKKRLK
RHGKYCHLRGGGGGGGGYAPYGRPGRGLRAATPVIQACYPSPVGPPPPPA
AEPPSGPEAAVNTHCAELYASGPGPAAALCASERRCSPLCGLDLSKKSPP
GSAAPERPLAERELPPRPDSPPSAGPAAYKEPPLALPSLPPLPFQKLEEA
APPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELGRERG
SPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDYKSSS
EETGSSEDPSPPGGHLEGYPCPHLAYGEPESFGDNLYVCIPCGKGFPSSE
QLNAHVEAHVEEEEALYGRAEAAEVAAGAAGLGPPFGGGGDKVAGAPGGL
GELLRPYRCASCDKSYKDPATLRQHEKTHWLTRPYPCTICGKKFTQRGTM
TRHMRSHLGLKPFACDACGMRFTRQYRLTEHMRIHSGEKPYECQVCGGKF
AQQRNLISHMKMHAVGGAAGAAGALAGLGGLPGVPGPDGKGKLDFPEGVF
AVARLTAEQLSLKQQDKAAAAELLAQTTHFLHDPKVALESLYPLAKFTAE
LGLSPDKAAEVLSQGAHLAAGPDGRTIDRFSPT

Кодований геном білок за функціями належить до репресорів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, сигнальний шлях Wnt, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Deltour S., Guerardel C., Leprince D. (1999). Recruitment of SMRT/N-CoR-mSin3A-HDAC-repressing complexes is not a general mechanism for BTB/POZ transcriptional repressors: the case of HIC-1 and gammaFBP-B.. Proc. Natl. Acad. Sci. U.S.A. 96: 14831 — 14836.  PubMed DOI:10.1073/pnas.96.26.14831
  • Deltour S., Pinte S., Guerardel C., Leprince D. (2001). Characterization of HRG22, a human homologue of the putative tumor suppressor gene HIC1.. Biochem. Biophys. Res. Commun. 287: 427 — 434.  PubMed DOI:10.1006/bbrc.2001.5624
  • Deltour S., Pinte S., Guerardel C., Wasylyk B., Leprince D. (2002). The human candidate tumor suppressor gene HIC1 recruits CtBP through a degenerate GLDLSKK motif.. Mol. Cell. Biol. 22: 4890 — 4901.  PubMed DOI:10.1128/MCB.22.13.4890-4901.2002
  • Briones V.R., Chen S., Riegel A.T., Lechleider R.J. (2006). Mechanism of fibroblast growth factor-binding protein 1 repression by TGF-beta.. Biochem. Biophys. Res. Commun. 345: 595 — 601.  PubMed DOI:10.1016/j.bbrc.2006.04.052
  • Valenta T., Lukas J., Doubravska L., Fafilek B., Korinek V. (2006). HIC1 attenuates Wnt signaling by recruitment of TCF-4 and beta-catenin to the nuclear bodies.. EMBO J. 25: 2326 — 2337.  PubMed DOI:10.1038/sj.emboj.7601147
  • Van Rechem C., Boulay G., Leprince D. (2009). HIC1 interacts with a specific subunit of SWI/SNF complexes, ARID1A/BAF250A.. Biochem. Biophys. Res. Commun. 385: 586 — 590.  PubMed DOI:10.1016/j.bbrc.2009.05.115

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4909 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q14526 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]