AHRR

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
AHRR
Ідентифікатори
Символи AHRR, AHH, AHHR, bHLHe77, aryl-hydrocarbon receptor repressor
Зовнішні ІД OMIM: 606517 MGI: 1333776 HomoloGene: 49215 GeneCards: AHRR
Пов'язані генетичні захворювання
муковісцидоз[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020731
NM_001242412
NM_001377236
NM_001377239
NM_009644
NM_001317351
RefSeq (білок)
NP_001229341
NP_065782
NP_001364165
NP_001364168
NP_001304280
NP_033774
Локус (UCSC) Хр. 5: 0.27 – 0.44 Mb Хр. 13: 74.21 – 74.29 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

AHRR (англ. Aryl-hydrocarbon receptor repressor) – білок, який кодується однойменним геном, розташованим у людей на 5-ї хромосомі.[4] Довжина поліпептидного ланцюга білка становить 701 амінокислот, а молекулярна маса — 76 265[5].

Послідовність амінокислот
1020304050
MPRTMIPPGECTYAGRKRRRPLQKQRPAVGAEKSNPSKRHRDRLNAELDH
LASLLPFPPDIISKLDKLSVLRLSVSYLRVKSFFQVVQEQSSRQPAAGAP
SPGDSCPLAGSAVLEGRLLLESLNGFALVVSAEGTIFYASATIVDYLGFH
QTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVVFGQPPPLETGDDAIL
GRLLRAQEWGTGTPTEYSAFLTRCFICRVRCLLDSTSGFLTMQFQGKLKF
LFGQKKKAPSGAMLPPRLSLFCIAAPVLLPSAAEMKMRSALLRAKPRADT
AATADAKVKATTSLCESELHGKPNYSAGRSSRESGVLVLREQTDAGRWAQ
VPARAPCLCLRGGPDLVLDPKGGSGDREEEQHRMLSRASGVTGRRETPGP
TKPLPWTAGKHSEDGARPRLQPSKNDPPSLRPMPRGSCLPCPCVQGTFRN
SPISHPPSPSPSAYSSRTSRPMRDVGEDQVHPPLCHFPQRSLQHQLPQPG
AQRFATRGYPMEDMKLQGVPMPPGDLCGPTLLLDVSIKMEKDSGCEGAAD
GCVPSQVWLGASDRSHPATFPTRMHLKTEPDSRQQVYISHLGHGVRGAQP
HGRATAGRSRELTPFHPAHCACLEPTDGLPQSEPPHQLCARGRGEQSCTC
RAAEAAPVVKREPLDSPQWATHSQGMVPGMLPKSALATLVPPQASGCTFL
P

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kanno Y., Miyama Y., Takane Y., Nakahama T., Inouye Y. (2007). Identification of intracellular localization signals and of mechanisms underlining the nucleocytoplasmic shuttling of human aryl hydrocarbon receptor repressor.. Biochem. Biophys. Res. Commun. 364: 1026 — 1031.  PubMed DOI:10.1016/j.bbrc.2007.10.140

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]