TP63

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TP63
Protein TP73L PDB 1rg6.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TP63, AIS, B(p51A), B(p51B), EEC3, KET, LMS, NBP, OFC8, RHS, SHFM4, TP53CP, TP53L, TP73L, p40, p51, p53CP, p63, p73H, p73L, tumor protein p63
Зовнішні ІД OMIM: 603273 MGI: 1330810 HomoloGene: 31189 GeneCards: TP63
Пов'язані генетичні захворювання
adenocarcinoma of the lung, lymphoblastic leukemia, рак легень, ADULT syndrome, Limb–mammary syndrome[1]
Шаблон експресії
PBB GE TP73L 209863 s at fs.png

PBB GE TP73L 211194 s at fs.png

PBB GE TP73L 211195 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 3: 189.63 – 189.9 Mb Хр. 16: 25.68 – 25.89 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TP63 (англ. Tumor protein p63) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 680 амінокислот, а молекулярна маса — 76 785[5].

Послідовність амінокислот
1020304050
MNFETSRCATLQYCPDPYIQRFVETPAHFSWKESYYRSTMSQSTQTNEFL
SPEVFQHIWDFLEQPICSVQPIDLNFVDEPSEDGATNKIEISMDCIRMQD
SDLSDPMWPQYTNLGLLNSMDQQIQNGSSSTSPYNTDHAQNSVTAPSPYA
QPSSTFDALSPSPAIPSNTDYPGPHSFDVSFQQSSTAKSATWTYSTELKK
LYCQIAKTCPIQIKVMTPPPQGAVIRAMPVYKKAEHVTEVVKRCPNHELS
REFNEGQIAPPSHLIRVEGNSHAQYVEDPITGRQSVLVPYEPPQVGTEFT
TVLYNFMCNSSCVGGMNRRPILIIVTLETRDGQVLGRRCFEARICACPGR
DRKADEDSIRKQQVSDSTKNGDGTKRPFRQNTHGIQMTSIKKRRSPDDEL
LYLPVRGRETYEMLLKIKESLELMQYLPQHTIETYRQQQQQQHQHLLQKQ
TSIQSPSSYGNSSPPLNKMNSMNKLPSVSQLINPQQRNALTPTTIPDGMG
ANIPMMGTHMPMAGDMNGLSPTQALPPPLSMPSTSHCTPPPPYPTDCSIV
SFLARLGCSSCLDYFTTQGLTTIYQIEHYSMDDLASLKIPEQFRHAIWKG
ILDHRQLHEFSSPSHLLRTPSSASTVSVGSSETRGERVIDAVRFTLRQTI
SFPPRDEWNDFNFDMDARRNKQQRIKEEGE

Кодований геном білок за функціями належить до активаторів, білків розвитку. Задіяний у таких біологічних процесах як апоптоз, транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Augustin M., Bamberger C., Paul D., Schmale H. (1998). Cloning and chromosomal mapping of the human p53-related KET gene to chromosome 3q27 and its murine homolog Ket to mouse chromosome 16.. Mamm. Genome 9: 899 — 902.  PubMed DOI:10.1007/s003359900891
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kim E.-J., Park J.-S., Um S.-J. (2002). Identification and characterization of HIPK2 interacting with p73 and modulating functions of the p53 family in vivo.. J. Biol. Chem. 277: 32020 — 32028.  PubMed DOI:10.1074/jbc.M200153200
  • Zeng S.X., Dai M.-S., Keller D.M., Lu H. (2002). SSRP1 functions as a co-activator of the transcriptional activator p63.. EMBO J. 21: 5487 — 5497.  PubMed DOI:10.1093/emboj/cdf540
  • Li Y., Zhou Z., Chen C. (2008). WW domain-containing E3 ubiquitin protein ligase 1 targets p63 transcription factor for ubiquitin-mediated proteasomal degradation and regulates apoptosis.. Cell Death Differ. 15: 1941 — 1951.  PubMed DOI:10.1038/cdd.2008.134
  • Zheng M.Z., Zheng L.M., Zeng Y.X. (2008). SCC-112 gene is involved in tumor progression and promotes the cell proliferation in G2/M phase.. J. Cancer Res. Clin. Oncol. 134: 453 — 462.  PubMed DOI:10.1007/s00432-007-0306-x

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]