RB (білок)

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RB (білок)
Ідентифікатори
Символи prepro-retinoblastoma-associated proteinexon 17 tumor GOS561 substitution mutation causes premature stopp105-RbRB1pRbpp110protein phosphatase 1regulatory subunit 130retinoblastoma suspectibility proteinGOS563 exon 17 substitution mutation causes premature stopRbretinoblastoma-associated proteinretinoblastoma 1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

RB, білок ретинобластоми (англ. RB transcriptional corepressor 1) — білок, який кодується геном супресором пухлин RB1, розташованим у людини на довгому плечі 13-ї хромосоми[1]. Довжина поліпептидного ланцюга білка становить 928 амінокислот, а молекулярна маса — 106 159[2]. Уперше виявлений під час вивчення спадкової форми раку сітківки у дітей — ретинобластоми, через що й отримав свою назву. Його функцією є стримання клітинного циклу, зокрема проходження через точку контролю G1/S. Проте втрата обидвох робочих копій гена Rb не одразу призводить до надмірної проліферації й виникнення пухлин сітківки та інших тканин, оскільки існують допоміжні механізми зупинки клітинного циклу в тій же фазі[3].

Послідовність амінокислот
1020304050
MPPKTPRKTAATAAAAAAEPPAPPPPPPPEEDPEQDSGPEDLPLVRLEFE
ETEEPDFTALCQKLKIPDHVRERAWLTWEKVSSVDGVLGGYIQKKKELWG
ICIFIAAVDLDEMSFTFTELQKNIEISVHKFFNLLKEIDTSTKVDNAMSR
LLKKYDVLFALFSKLERTCELIYLTQPSSSISTEINSALVLKVSWITFLL
AKGEVLQMEDDLVISFQLMLCVLDYFIKLSPPMLLKEPYKTAVIPINGSP
RTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPFM
NSLGLVTSNGLPEVENLSKRYEEIYLKNKDLDARLFLDHDKTLQTDSIDS
FETQRTPRKSNLDEEVNVIPPHTPVRTVMNTIQQLMMILNSASDQPSENL
ISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGV
RLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSR
STSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHL
ERCEHRIMESLAWLSDSPLFDLIKQSKDREGPTDHLESACPLNLPLQNNH
TAADMYLSPVRSPKKKGSTTRVNSTANAETQATSAFQTQKPLKSTSLSLF
YKKVYRLAYLRLNTLCERLLSEHPELEHIIWTLFQHTLQNEYELMRDRHL
DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYD
SIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIP
GGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQ
MVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQK
LAEMTSTRTRMQKQKMNDSMDTSNKEEK

Цей білок за функціями належить до репресорів, регуляторів хроматину. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, регуляція транскрипції, ацетилювання та метилювання хроматину. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Функція[ред. | ред. код]

Білок Rb виконує свою функцію шляхом зв'язування та інактивації групи транскрипційних факторів E2F. Ці білки в активному стані приєднуються до специфічних послідовностей у промоторних ділянках широкого спектра генів, продукти яких необхідні для проходження S-фази клітинного циклу, зокрема такі як G1/S-цикліни, S-цикліни, ферменти та інші білки, необхідні для реплікації ДНК і подвоєння хромосом. За браку мітогенних стимулів Rb пригнічує активність білків E2F і не пропускає клітину в S-фазу[3].

Коли клітина отримує сигнал, який спонукає її до поділу, у ній накопичуються G1-циклін-залежні кінази, які фосфорилюють Rb і переводять його в неактивну форму. У такому разі інгібування знімається із факторів транскрипції E2F, і вони можуть запускати S-фазу[3].

Роль у пухлинах[ред. | ред. код]

Ген Rb був виявлений під час вивчення рідкісного спадкового захворювання — ретинобластоми. Для деяких особин, що страждають цією хворобою, характерний візуально аномальний каріотип: у них бракує однієї специфічної смуги на 13-й хромосомі. Делеція тієї ж ділянки спостерігається у деяких пацієнтів із неспадковою формою захворювання. Ці дані дозволили клонувати ген Rb. Було з'ясовано, що в людей, уражених спадковою формою ретинобластоми, цей ген делетований або в ньому відбулась мутація, яка призвела до втрати функції, в одній із двох копій 13-ї хромосоми в кожній соматичній клітині. Такі клітини є більш схильними до злоякісного переродження, проте воно відбувається тільки в разі інактивації нормальної копії гена Rb[4]. Це може статися шляхом втрати однієї хромосоми з подальшою дуплікацією хромосоми із мутантним або делетованим геном, мітотичної рекомбінації, конверсії генів, делеції або точкової мутації[5]. Такі події трапляються з частотою, що дозволяє незалежне виникнення великої кількості пухлин в обидвох очах[4].

Неспадкова форма ретинобластоми трапляється дуже рідко, оскільки для її виникнення необхідна інактивація обидвох нормальних копій гена Rb. При цьому виникає тільки одна пухлина в одному оці. Функціонального Rb також бракує у кількох інших типах ракових захворювань, зокрема карциномах легень, молочної залози, сечового міхура. Ці злоякісні пухлини виникають внаслідок складнішої серії генетичних змін ніж ретинобластома і з'являються пізніше у житті людини[4]. У багатьох інших типах злоякісних новоутворень сигнальний шлях Rb інактивується через зміни в роботі інших його компонентів[6].

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:9884 (англ.). Процитовано 26 квітня 2018. 
  2. UniProt, P06400 (англ.). Процитовано 26 квітня 2018. 
  3. а б в Alberts et al, 2007, с. 1103—1105
  4. а б в Alberts et al, 2007, с. 1234
  5. Alberts et al, 2007, с. 1236
  6. Alberts et al, 2007, с. 1243

Джерела[ред. | ред. код]

Література[ред. | ред. код]

  • McGee T.L., Yandell D.W., Dryja T.P. (1989). Structure and partial genomic sequence of the human retinoblastoma susceptibility gene.. Gene 80: 119 — 128.  PubMed DOI:10.1016/0378-1119(89)90256-4
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lohmann D.R., Brandt B., Hopping W., Passarge E., Horsthemke B. (1994). Spectrum of small length germline mutations in the RB1 gene.. Hum. Mol. Genet. 3: 2187 — 2193.  PubMed DOI:10.1093/hmg/3.12.2187
  • Meyerson M., Harlow E. (1994). Identification of G1 kinase activity for cdk6, a novel cyclin D partner.. Mol. Cell. Biol. 14: 2077 — 2086.  PubMed DOI:10.1128/MCB.14.3.2077
  • Durfee T., Mancini M.A., Jones D., Elledge S.J., Lee W.H. (1994). The amino-terminal region of the retinoblastoma gene product binds a novel nuclear matrix protein that co-localizes to centers for RNA processing.. J. Cell Biol. 127: 609 — 622.  PubMed DOI:10.1083/jcb.127.3.609
  • Kim Y.W., Otterson G.A., Kratzke R.A., Coxon A.B., Kaye F.J. (1994). Differential specificity for binding of retinoblastoma binding protein 2 to RB, p107, and TATA-binding protein.. Mol. Cell. Biol. 14: 7256 — 7264.  PubMed DOI:10.1128/MCB.14.11.7256

Див. також[ред. | ред. код]