ESRRA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ESRRA
Protein ESRRA PDB 1lo1.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи ESRRA, ERR1, ERRa, ERRalpha, ESRL1, NR3B1, estrogen related receptor alpha
Зовнішні ІД OMIM: 601998 HomoloGene: 136738 GeneCards: ESRRA
Реагує на сполуку
biochanin A, daidzein, Геністейн, XCT790[1]
Шаблон експресії
PBB GE ESRRA 1487 at fs.png

PBB GE ESRRA 203193 at tn.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001282450
NM_001282451
NM_004451
н/д
RefSeq (білок)
NP_001269379
NP_001269380
NP_004442
н/д
Локус (UCSC) Хр. 11: 64.31 – 64.32 Mb н/д
PubMed search [2] н/д
Вікідані
Див./Ред. для людей

ESRRA (англ. Estrogen related receptor alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 423 амінокислот, а молекулярна маса — 45 510[4].

Послідовність амінокислот
1020304050
MSSQVVGIEPLYIKAEPASPDSPKGSSETETEPPVALAPGPAPTRCLPGH
KEEEDGEGAGPGEQGGGKLVLSSLPKRLCLVCGDVASGYHYGVASCEACK
AFFKRTIQGSIEYSCPASNECEITKRRRKACQACRFTKCLRVGMLKEGVR
LDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNALVSH
LLVVEPEKLYAMPDPAGPDGHLPAVATLCDLFDREIVVTISWAKSIPGFS
SLSLSDQMSVLQSVWMEVLVLGVAQRSLPLQDELAFAEDLVLDEEGARAA
GLGELGAALLQLVRRLQALRLEREEYVLLKALALANSDSVHIEDAEAVEQ
LREALHEALLEYEAGRAGPGGGAERRRAGRLLLTLPLLRQTAGKVLAHFY
GVKLEGKVPMHKLFLEMLEAMMD

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Giguere V., Yang N., Segui P., Evans R.M. (1988). Identification of a new class of steroid hormone receptors.. Nature 331: 91 — 94.  PubMed DOI:10.1038/331091a0
  • Yang N., Shigeta H., Shi H., Teng C.T. (1996). Estrogen-related receptor, hERR1, modulates estrogen receptor-mediated response of human lactoferrin gene promoter.. J. Biol. Chem. 271: 5795 — 5804.  PubMed DOI:10.1074/jbc.271.10.5795
  • Sladek R., Bader J.-A., Giguere V. (1997). The orphan nuclear receptor estrogen-related receptor alpha is a transcriptional regulator of the human medium-chain acyl coenzyme A dehydrogenase gene.. Mol. Cell. Biol. 17: 5400 — 5409.  PubMed DOI:10.1128/MCB.17.9.5400
  • Schreiber S.N., Knutti D., Brogli K., Uhlmann T., Kralli A. (2003). The transcriptional coactivator PGC-1 regulates the expression and activity of the orphan nuclear receptor estrogen-related receptor alpha (ERRalpha).. J. Biol. Chem. 278: 9013 — 9018.  PubMed DOI:10.1074/jbc.M212923200
  • Barry J.B., Laganiere J., Giguere V. (2006). A single nucleotide in an estrogen-related receptor alpha site can dictate mode of binding and peroxisome proliferator-activated receptor gamma coactivator 1alpha activation of target promoters.. Mol. Endocrinol. 20: 302 — 310.  PubMed DOI:10.1210/me.2005-0313
  • Vu E.H., Kraus R.J., Mertz J.E. (2007). Phosphorylation-dependent sumoylation of estrogen-related receptor alpha1.. Biochemistry 46: 9795 — 9804.  PubMed DOI:10.1021/bi700316g

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]