NFE2L1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFE2L1
Ідентифікатори
Символи NFE2L1, LCR-F1, NRF1, TCF11, nuclear factor, erythroid 2 like 1
Зовнішні ІД OMIM: 163260 MGI: 99421 HomoloGene: 20685 GeneCards: NFE2L1
Шаблон експресії
PBB GE NFE2L1 200758 s at fs.png

PBB GE NFE2L1 214179 s at fs.png

PBB GE NFE2L1 200759 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003204
NM_001330261
NM_001330262
RefSeq (білок)
NP_001317190
NP_001317191
NP_003195
Локус (UCSC) Хр. 17: 48.05 – 48.06 Mb Хр. 11: 96.82 – 96.83 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFE2L1 (англ. Nuclear factor, erythroid 2 like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 772 амінокислот, а молекулярна маса — 84 704[4].

Послідовність амінокислот
1020304050
MLSLKKYLTEGLLQFTILLSLIGVRVDVDTYLTSQLPPLREIILGPSSAY
TQTQFHNLRNTLDGYGIHPKSIDLDNYFTARRLLSQVRALDRFQVPTTEV
NAWLVHRDPEGSVSGSQPNSGLALESSSGLQDVTGPDNGVRESETEQGFG
EDLEDLGAVAPPVSGDLTKEDIDLIDILWRQDIDLGAGREVFDYSHRQKE
QDVEKELRDGGEQDTWAGEGAEALARNLLVDGETGESFPAQVPSGEDQTA
LSLEECLRLLEATCPFGENAEFPADISSITEAVPSESEPPALQNNLLSPL
LTGTESPFDLEQQWQDLMSIMEMQAMEVNTSASEILYSAPPGDPLSTNYS
LAPNTPINQNVSLHQASLGGCSQDFLLFSPEVESLPVASSSTLLPLAPSN
STSLNSTFGSTNLTGLFFPPQLNGTANDTAGPELPDPLGGLLDEAMLDEI
SLMDLAIEEGFNPVQASQLEEEFDSDSGLSLDSSHSPSSLSSSEGSSSSS
SSSSSSSSSASSSASSSFSEEGAVGYSSDSETLDLEEAEGAVGYQPEYSK
FCRMSYQDPAQLSCLPYLEHVGHNHTYNMAPSALDSADLPPPSALKKGSK
EKQADFLDKQMSRDEHRARAMKIPFTNDKIINLPVEEFNELLSKYQLSEA
QLSLIRDIRRRGKNKMAAQNCRKRKLDTILNLERDVEDLQRDKARLLREK
VEFLRSLRQMKQKVQSLYQEVFGRLRDENGRPYSPSQYALQYAGDGSVLL
IPRTMADQQARRQERKPKDRRK

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, мембрані, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Chan J.Y., Han X.-L., Kan Y.W. (1993). Cloning of Nrf1, an NF-E2-related transcription factor, by genetic selection in yeast.. Proc. Natl. Acad. Sci. U.S.A. 90: 11371 — 11375.  PubMed DOI:10.1073/pnas.90.23.11371
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Caterina J.J., Donze D., Sun C.W., Ciavatta D.J., Townes T.M. (1994). Cloning and functional characterization of LCR-F1: a bZIP transcription factor that activates erythroid-specific, human globin gene expression.. Nucleic Acids Res. 22: 2383 — 2391.  PubMed DOI:10.1093/nar/22.12.2383
  • Wang W., Chan J.Y. (2006). Nrf1 is targeted to the endoplasmic reticulum membrane by an N-terminal transmembrane domain. Inhibition of nuclear translocation and transacting function.. J. Biol. Chem. 281: 19676 — 19687.  PubMed DOI:10.1074/jbc.M602802200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7781 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q14494 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]