TAF6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF6
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF6, MGC:8964, TAF(II)70, TAF(II)80, TAF2E, TAFII-70, TAFII-80, TAFII70, TAFII80, TAFII85, TATA-box binding protein associated factor 6, ALYUS
Зовнішні ІД OMIM: 602955 MGI: 109129 HomoloGene: 7561 GeneCards: TAF6
Шаблон експресії
PBB GE TAF6 203572 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_009315
NM_001356600
NM_001356601
NM_001356602
RefSeq (білок)
NP_033341
NP_001343529
NP_001343530
NP_001343531
Локус (UCSC) Хр. 7: 100.11 – 100.12 Mb Хр. 5: 138.18 – 138.19 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF6 (англ. TATA-box binding protein associated factor 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 677 амінокислот, а молекулярна маса — 72 668[4].

Послідовність амінокислот
1020304050
MAEEKKLKLSNTVLPSESMKVVAESMGIAQIQEETCQLLTDEVSYRIKEI
AQDALKFMHMGKRQKLTTSDIDYALKLKNVEPLYGFHAQEFIPFRFASGG
GRELYFYEEKEVDLSDIINTPLPRVPLDVCLKAHWLSIEGCQPAIPENPP
PAPKEQQKAEATEPLKSAKPGQEEDGPLKGKGQGATTADGKGKEKKAPPL
LEGAPLRLKPRSIHELSVEQQLYYKEITEACVGSCEAKRAEALQSIATDP
GLYQMLPRFSTFISEGVRVNVVQNNLALLIYLMRMVKALMDNPTLYLEKY
VHELIPAVMTCIVSRQLCLRPDVDNHWALRDFAARLVAQICKHFSTTTNN
IQSRITKTFTKSWVDEKTPWTTRYGSIAGLAELGHDVIKTLILPRLQQEG
ERIRSVLDGPVLSNIDRIGADHVQSLLLKHCAPVLAKLRPPPDNQDAYRA
EFGSLGPLLCSQVVKARAQAALQAQQVNRTTLTITQPRPTLTLSQAPQPG
PRTPGLLKVPGSIALPVQTLVSARAAAPPQPSPPPTKFIVMSSSSSAPST
QQVLSLSTSAPGSGSTTTSPVTTTVPSVQPIVKLVSTATTAPPSTAPSGP
GSVQKYIVVSLPPTGEGKGGPTSHPSPVPPPASSPSPLSGSALCGGKQEA
GDSPPPAPGTPKANGSQPNSGSPQPAP

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cavusoglu N., Brand M., Tora L., van Dorsselaer A. (2003). Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.. Proteomics 3: 217 — 223.  PubMed DOI:10.1002/pmic.200390030
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Weinzierl R.O., Ruppert S., Dynlacht B.D., Tanese N., Tjian R. (1993). Cloning and expression of Drosophila TAFII60 and human TAFII70 reveal conserved interactions with other subunits of TFIID.. EMBO J. 12: 5303 — 5309.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11540 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P49848 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]