Циклін D1

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з CCND1)
Перейти до навігації Перейти до пошуку
CCND1
Protein CCND1 PDB 2W96.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CCND1, BCL1, D11S287E, PRAD1, U21B31, cyclin D1
Зовнішні ІД OMIM: 168461 MGI: 88313 HomoloGene: 1334 GeneCards: CCND1
Пов'язані генетичні захворювання
мієломна хвороба[1]
Шаблон експресії
PBB GE CCND1 208712 at fs.png

PBB GE CCND1 208711 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_053056
NM_007631
RefSeq (білок)
NP_444284
NP_031657
Локус (UCSC) Хр. 11: 69.64 – 69.65 Mb Хр. 7: 144.93 – 144.94 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CCND1 (англ. Cyclin D1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 295 амінокислот, а молекулярна маса — 33 729[5].

Послідовність амінокислот
1020304050
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQK
EVLPSMRKIVATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQ
LLGATCMFVASKMKETIPLTAEKLCIYTDNSIRPEELLQMELLLVNKLKW
NLAAMTPHDFIEHFLSKMPEAEENKQIIRKHAQTFVALCATDVKFISNPP
SMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCDPDCLRACQEQ
IEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, поділ клітини, пошкодження ДНК. Локалізований у цитоплазмі, ядрі, мембрані.

Література[ред. | ред. код]

  • Lew D.J., Dulic V., Reed S.I. (1991). Isolation of three novel human cyclins by rescue of G1 cyclin (Cln) function in yeast.. Cell 66: 1197 — 1206.  PubMed DOI:10.1016/0092-8674(91)90042-W
  • Xiong Y., Connolly T., Futcher B., Beach D. (1991). Human D-type cyclin.. Cell 65: 691 — 699.  PubMed DOI:10.1016/0092-8674(91)90100-D
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Motokura T., Arnold A. (1993). The PRAD1/cyclin D1 proto-oncogene: genomic organization, 5' DNA sequence, and sequence of a tumor-specific rearrangement breakpoint.. Genes Chromosomes Cancer 7: 89 — 95.  PubMed DOI:10.1002/gcc.2870070205
  • Germain D., Russell A., Thompson A., Hendley J. (2000). Ubiquitination of free cyclin D1 is independent of phosphorylation on threonine 286.. J. Biol. Chem. 275: 12074 — 12079.  PubMed DOI:10.1074/jbc.275.16.12074
  • Liu W.D., Wang H.W., Muguira M., Breslin M.B., Lan M.S. (2006). INSM1 functions as a transcriptional repressor of the neuroD/beta2 gene through the recruitment of cyclin D1 and histone deacetylases.. Biochem. J. 397: 169 — 177.  PubMed DOI:10.1042/BJ20051669

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]