NR0B2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR0B2
Protein NR0B2 PDB 1YUC.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR0B2, SHP, SHP1, nuclear receptor subfamily 0 group B member 2
Зовнішні ІД OMIM: 604630 MGI: 1346344 HomoloGene: 8030 GeneCards: NR0B2
Шаблон експресії
PBB GE NR0B2 206410 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021969
NM_011850
RefSeq (білок)
NP_068804
NP_035980
Локус (UCSC) Хр. 1: 26.91 – 26.91 Mb Хр. 4: 133.55 – 133.56 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR0B2 (англ. Nuclear receptor subfamily 0 group B member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 257 амінокислот, а молекулярна маса — 28 058[4].

Послідовність амінокислот
1020304050
MSTSQPGACPCQGAASRPAILYALLSSSLKAVPRPRSRCLCRQHRPVQLC
APHRTCREALDVLAKTVAFLRNLPSFWQLPPQDQRRLLQGCWGPLFLLGL
AQDAVTFEVAEAPVPSILKKILLEEPSSSGGSGQLPDRPQPSLAAVQWLQ
CCLESFWSLELSPKEYACLKGTILFNPDVPGLQAASHIGHLQQEAHWVLC
EVLEPWCPAAQGRLTRVLLTASTLKSIPTSLLGDLFFRPIIGDVDIAGLL
GDMLLLR

Кодований геном білок за функціями належить до репресорів, рецепторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Seol W., Choi H.-S., Moore D.D. (1996). An orphan nuclear hormone receptor that lacks a DNA binding domain and heterodimerizes with other receptors.. Science 272: 1336 — 1339.  PubMed DOI:10.1126/science.272.5266.1336
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7961 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q15466 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]