TSHZ3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TSHZ3
Protein TSHZ3 PDB 2dmi.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TSHZ3, TSH3, ZNF537, teashirt zinc finger homeobox 3
Зовнішні ІД OMIM: 614119 MGI: 2442819 HomoloGene: 10835 GeneCards: TSHZ3
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_020856
NM_172298
RefSeq (білок)
NP_065907
NP_758502
Локус (UCSC) Хр. 19: 31.15 – 31.35 Mb Хр. 7: 36.7 – 36.77 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TSHZ3 (англ. Teashirt zinc finger homeobox 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 081 амінокислот, а молекулярна маса — 118 566[4].

Послідовність амінокислот
1020304050
MPRRKQQAPRRAAAYVSEELKAAALVDEGLDPEEHTADGEPSAKYMCPEK
ELARACPSYQNSPAAEFSCHEMDSESHISETSDRMADFESGSIKNEEETK
EVTVPLEDTTVSDSLEQMKAVYNNFLSNSYWSNLNLNLHQPSSEKNNGSS
SSSSSSSSSCGSGSFDWHQSAMAKTLQQVSQSRMLPEPSLFSTVQLYRQS
SKLYGSIFTGASKFRCKDCSAAYDTLVELTVHMNETGHYRDDNHETDNNN
PKRWSKPRKRSLLEMEGKEDAQKVLKCMYCGHSFESLQDLSVHMIKTKHY
QKVPLKEPVTPVAAKIIPATRKKASLELELPSSPDSTGGTPKATISDTND
ALQKNSNPYITPNNRYGHQNGASYAWHFEARKSQILKCMECGSSHDTLQE
LTAHMMVTGHFIKVTNSAMKKGKPIVETPVTPTITTLLDEKVQSVPLAAT
TFTSPSNTPASISPKLNVEVKKEVDKEKAVTDEKPKQKDKPGEEEEKCDI
SSKYHYLTENDLEESPKGGLDILKSLENTVTSAINKAQNGTPSWGGYPSI
HAAYQLPNMMKLSLGSSGKSTPLKPMFGNSEIVSPTKNQTLVSPPSSQTS
PMPKTNFHAMEELVKKVTEKVAKVEEKMKEPDGKLSPPKRATPSPCSSEV
GEPIKMEASSDGGFRSQENSPSPPRDGCKDGSPLAEPVENGKELVKPLAS
SLSGSTAIITDHPPEQPFVNPLSALQSVMNIHLGKAAKPSLPALDPMSML
FKMSNSLAEKAAVATPPPLQSKKADHLDRYFYHVNNDQPIDLTKGKSDKG
CSLGSVLLSPTSTAPATSSSTVTTAKTSAVVSFMSNSPLRENALSDISDM
LKNLTESHTSKSSTPSSISEKSDIDGATLEEAEESTPAQKRKGRQSNWNP
QHLLILQAQFAASLRQTSEGKYIMSDLSPQERMHISRFTGLSMTTISHWL
ANVKYQLRRTGGTKFLKNLDTGHPVFFCNDCASQIRTPSTYISHLESHLG
FRLRDLSKLSTEQINSQIAQTKSPSEKMVTSSPEEDLGTSYQCKLCNRTF
ASKHAVKLHLSKTHGKSPEDHLLYVSELEKQ

Кодований геном білок за функціями належить до репресорів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі, клітинних відростках.

Література[ред. | ред. код]

  • Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. (2000). Prediction of the coding sequences of unidentified human genes. XVII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.. DNA Res. 7: 143 — 150.  PubMed DOI:10.1093/dnares/7.2.143
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:30700 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q63HK5 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]