HOXB5

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXB5
Protein HOXB5 PDB 1hom.png
Ідентифікатори
Символи HOXB5, HHO.C10, HOX2, HOX2A, HU-1, Hox2.1, homeobox B5
Зовнішні ІД OMIM: 142960 MGI: 96186 HomoloGene: 37585 GeneCards: HOXB5
Шаблон експресії
PBB GE HOXB5 205601 s at fs.png

PBB GE HOXB5 205600 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002147
NM_008268
RefSeq (білок)
NP_002138
NP_032294
Локус (UCSC) Хр. 17: 48.59 – 48.59 Mb Хр. 11: 96.3 – 96.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXB5 (англ. Homeobox B5) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 269 амінокислот, а молекулярна маса — 29 434[4].

Послідовність амінокислот
1020304050
MSSYFVNSFSGRYPNGPDYQLLNYGSGSSLSGSYRDPAAMHTGSYGYNYN
GMDLSVNRSSASSSHFGAVGESSRAFPAPAQEPRFRQAASSCSLSSPESL
PCTNGDSHGAKPSASSPSDQATSASSSANFTEIDEASASSEPEEAASQLS
SPSLARAQPEPMATSTAAPEGQTPQIFPWMRKLHISHDMTGPDGKRARTA
YTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWK
KDNKLKSMSLATAGSAFQP

Кодований геном білок за функцією належить до білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Levine M., Rubin G.M., Tjian R. (1984). Human DNA sequences homologous to a protein coding region conserved between homeotic genes of Drosophila.. Cell 38: 667 — 673.  PubMed DOI:10.1016/0092-8674(84)90261-7
  • Galang C.K., Hauser C.A. (1992). Cooperative DNA binding of the highly conserved human Hox 2.1 homeodomain gene product.. New Biol. 4: 558 — 568.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5116 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P09067 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]