SOX6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SOX6
PBB Protein SOX6 image.jpg
Ідентифікатори
Символи SOX6, HSSOXD, SRY-box 6, SRY-box transcription factor 6
Зовнішні ІД OMIM: 607257 MGI: 98368 HomoloGene: 22631 GeneCards: SOX6
Пов'язані генетичні захворювання
остеопороз, Ожиріння[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 11: 15.97 – 16.74 Mb Хр. 7: 115.47 – 116.04 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SOX6 (англ. SRY-box 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 828 амінокислот, а молекулярна маса — 91 921[5].

Послідовність амінокислот
1020304050
MSSKQATSPFACAADGEDAMTQDLTSREKEEGSDQHVASHLPLHPIMHNK
PHSEELPTLVSTIQQDADWDSVLSSQQRMESENNKLCSLYSFRNTSTSPH
KPDEGSRDREIMTSVTFGTPERRKGSLADVVDTLKQKKLEEMTRTEQEDS
SCMEKLLSKDWKEKMERLNTSELLGEIKGTPESLAEKERQLSTMITQLIS
LREQLLAAHDEQKKLAASQIEKQRQQMDLARQQQEQIARQQQQLLQQQHK
INLLQQQIQVQGHMPPLMIPIFPHDQRTLAAAAAAQQGFLFPPGITYKPG
DNYPVQFIPSTMAAAAASGLSPLQLQKGHVSHPQINQRLKGLSDRFGRNL
DTFEHGGGHSYNHKQIEQLYAAQLASMQVSPGAKMPSTPQPPNTAGTVSP
TGIKNEKRGTSPVTQVKDEAAAQPLNLSSRPKTAEPVKSPTSPTQNLFPA
SKTSPVNLPNKSSIPSPIGGSLGRGSSLDILSSLNSPALFGDQDTVMKAI
QEARKMREQIQREQQQQQPHGVDGKLSSINNMGLNSCRNEKERTRFENLG
PQLTGKSNEDGKLGPGVIDLTRPEDAEGSKAMNGSAAKLQQYYCWPTGGA
TVAEARVYRDARGRASSEPHIKRPMNAFMVWAKDERRKILQAFPDMHNSN
ISKILGSRWKSMSNQEKQPYYEEQARLSKIHLEKYPNYKYKPRPKRTCIV
DGKKLRIGEYKQLMRSRRQEMRQFFTVGQQPQIPITTGTGVVYPGAITMA
TTTPSPQMTSDCSSTSASPEPSLPVIQSTYGMKTDGGSLAGNEMINGEDE
MEMYDDYEDDPKSDYSSENEAPEAVSAN

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Cohen-Barak O., Hagiwara N., Arlt M.F., Horton J.P., Brilliant M.H. (2001). Cloning, characterization and chromosome mapping of the human SOX6 gene.. Gene 265: 157 — 164.  PubMed DOI:10.1016/S0378-1119(01)00346-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]