FOXK1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXK1
Protein FOXK1 PDB 2a3s.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FOXK1, FOXK1L, forkhead box K1
Зовнішні ІД OMIM: 616302 MGI: 1347488 HomoloGene: 82414 GeneCards: FOXK1
Шаблон експресії
PBB GE FOXK1 gnf1h04694 s at fs.png

PBB GE FOXK1 gnf1h04695 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001037165
NM_010812
NM_199068
RefSeq (білок)
NP_001032242
NP_951031
Локус (UCSC) Хр. 7: 4.68 – 4.77 Mb Хр. 5: 142.4 – 142.46 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXK1 (англ. Forkhead box K1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 733 амінокислот, а молекулярна маса — 75 457[4].

Послідовність амінокислот
1020304050
MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPAAAPPPAPAQPQPPP
GPPPPPPPPLPPGAIAGAGSSGGSSGVSGDSAVAGAAPALVAAAAASVRQ
SPGPALARLEGREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQ
LSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPKQCTFRFPSTAIKIQ
FTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSMVSPVPSPTGTISV
PNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADTSGGDSP
KDESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQ
NSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQR
GVSCFRTPFGPLSSRSAPASPTHPGLMSPRSGGLQTPECLSREGSPIPHD
PEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAKPVAYMPA
SIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYILTSQGAAGGSH
DAAGAAVLDLGSEARGLEEKPTIAFATIPAAGGVIQTVASQMAPGVPGHT
VTILQPATPVTLGQHHLPVRAVTQNGKHAVPTNSLAGNAYALTSPLQLLA
TQASSSAPVVVTRVCEVGPKEPAAAVAATATTTPATATTASASASSTGEP
EVKRSRVEEPSGAVTTPAGVIAAAGPQGPGTGE

Кодований геном білок за функціями належить до репресорів, активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, міогенез, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Katoh M., Katoh M. (2004). Identification and characterization of human FOXK1 gene in silico.. Int. J. Mol. Med. 14: 127 — 132.  PubMed
  • Huang J.T., Lee V. (2004). Identification and characterization of a novel human FOXK1 gene in silico.. Int. J. Oncol. 25: 751 — 757.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:23480 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P85037 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]