PHF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PHF1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PHF1, MTF2L2, PCL1, PHF2, TDRD19C, hPHD finger protein 1
Зовнішні ІД OMIM: 602881 MGI: 98647 HomoloGene: 7567 GeneCards: PHF1
Шаблон експресії
PBB GE PHF1 202928 s at fs.png

PBB GE PHF1 40446 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002636
NM_024165
NM_009343
NM_001302397
RefSeq (білок)
NP_002627
NP_077084
NP_001289326
NP_033369
Локус (UCSC) Хр. 6: 33.41 – 33.42 Mb Хр. 17: 26.93 – 26.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PHF1 (англ. PHD finger protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 567 амінокислот, а молекулярна маса — 62 106[4].

Послідовність амінокислот
1020304050
MAQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGT
IKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
GNRLVSCEKCRHAYHQDCHVPRAPAPGEGEGTSWVCRQCVFAIATKRGGA
LKKGPYARAMLGMKLSLPYGLKGLDWDAGHLSNRQQSYCYCGGPGEWNLK
MLQCRSCLQWFHEACTQCLSKPLLYGDRFYEFECCVCRGGPEKVRRLQLR
WVDVAHLVLYHLSVCCKKKYFDFDREILPFTSENWDSLLLGELSDTPKGE
RSSRLLSALNSHKDRFISGREIKKRKCLFGLHARMPPPVEPPTGDGALTS
FPSGQGPGGGVSRPLGKRRRPEPEPLRRRQKGKVEELGPPSAVRNQPEPQ
EQRERAHLQRALQASVSPPSPSPNQSYQGSSGYNFRPTDARCLPSSPIRM
FASFHPSASTAGTSGDSGPPDRSPLELHIGFPTDIPKSAPHSMTASSSSV
SSPSPGLPRRSAPPSPLCRSLSPGTGGGVRGGVGYLSRGDPVRVLARRVR
PDGSVQYLVEWGGGGIF

Кодований геном білок за функціями належить до репресорів, регуляторів хроматину, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, пошкодження ДНК, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у цитоплазмі, цитоскелеті, ядрі.

Література[ред. | ред. код]

  • Coulson M., Robert S., Eyre H.J., Saint R. (1998). The identification and localization of a human gene with sequence similarity to Polycomblike of Drosophila melanogaster.. Genomics 48: 381 — 383.  PubMed DOI:10.1006/geno.1997.5201
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Micci F., Panagopoulos I., Bjerkehagen B., Heim S. (2006). Consistent rearrangement of chromosomal band 6p21 with generation of fusion genes JAZF1/PHF1 and EPC1/PHF1 in endometrial stromal sarcoma.. Cancer Res. 66: 107 — 112.  PubMed DOI:10.1158/0008-5472.CAN-05-2485
  • Sarma K., Margueron R., Ivanov A., Pirrotta V., Reinberg D. (2008). Ezh2 requires PHF1 to efficiently catalyze H3 lysine 27 trimethylation in vivo.. Mol. Cell. Biol. 28: 2718 — 2731.  PubMed DOI:10.1128/MCB.02017-07

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8919 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, O43189 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]