NFKB2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFKB2
Protein NFKB2 PDB 1a3q.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFKB2, CVID10, H2TF1, LYT-10, LYT10, NF-kB2, p105, p52, p100, p49/p100, nuclear factor kappa B subunit 2
Зовнішні ІД OMIM: 164012 MGI: 1099800 HomoloGene: 1873 GeneCards: NFKB2
Шаблон експресії
PBB GE NFKB2 207535 s at fs.png

PBB GE NFKB2 209636 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001177369
NM_001177370
NM_019408
RefSeq (білок)
NP_001170840
NP_001170841
NP_062281
Локус (UCSC) Хр. 10: 102.39 – 102.4 Mb Хр. 19: 46.3 – 46.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFKB2 (англ. Nuclear factor kappa B subunit 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 900 амінокислот, а молекулярна маса — 96 749[4].

Послідовність амінокислот
1020304050
MESCYNPGLDGIIEYDDFKLNSSIVEPKEPAPETADGPYLVIVEQPKQRG
FRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSD
PPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTM
IQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRA
SDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLC
DKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPF
GGGSHMGGGSGGAAGGYGGAGGGGSLGFFPSSLAYSPYQSGAGPMGCYPG
GGGGAQMAATVPSRDSGEEAAEPSAPSRTPQCEPQAPEMLQRAREYNARL
FGLAQRSARALLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHGQ
TSVIEQIVYVIHHAQDLGVVNLTNHLHQTPLHLAVITGQTSVVSFLLRVG
ADPALLDRHGDSAMHLALRAGAGAPELLRALLQSGAPAVPQLLHMPDFEG
LYPVHLAVRARSPECLDLLVDSGAEVEATERQGGRTALHLATEMEELGLV
THLVTKLRANVNARTFAGNTPLHLAAGLGYPTLTRLLLKAGADIHAENEE
PLCPLPSPPTSDSDSDSEGPEKDTRSSFRGHTPLDLTCSTKVKTLLLNAA
QNTMEPPLTPPSPAGPGLSLGDTALQNLEQLLDGPEAQGSWAELAERLGL
RSLVDTYRQTTSPSGSLLRSYELAGGDLAGLLEALSDMGLEEGVRLLRGP
ETRDKLPSTAEVKEDSAYGSQSVEQEAEKLGPPPEPPGGLCHGHPQPQVH

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Schmid R.M., Perkins N.D., Duckett C.S., Andrews P.C., Nabel G.J. (1991). Cloning of an NF-kappa B subunit which stimulates HIV transcription in synergy with p65.. Nature 352: 733 — 736.  PubMed DOI:10.1038/352733a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Liptay S., Schmid R.M., Nabel E.G., Nabel G.J. (1994). Transcriptional regulation of NF-kappa B2: evidence for kappa B-mediated positive and negative autoregulation.. Mol. Cell. Biol. 14: 7695 — 7703.  PubMed DOI:10.1128/MCB.14.12.7695
  • Li Z., Nabel G.J. (1997). A new member of the IkappaB protein family, IkappaB epsilon, inhibits RelA (p65)-mediated NF-kappaB transcription.. Mol. Cell. Biol. 17: 6184 — 6190.  PubMed DOI:10.1128/MCB.17.10.6184
  • Heusch M., Lin L., Geleziunas R., Greene W.C. (1999). The generation of nfkb2 p52: mechanism and efficiency.. Oncogene 18: 6201 — 6208.  PubMed DOI:10.1038/sj.onc.1203022
  • Betts J.C., Nabel G.J. (1996). Differential regulation of NF-kappaB2(p100) processing and control by amino-terminal sequences.. Mol. Cell. Biol. 16: 6363 — 6371.  PubMed DOI:10.1128/MCB.16.11.6363

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7795 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q00653 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]