ZNF43

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF43
Ідентифікатори
Символи ZNF43, HTF6, KOX27, ZNF39L1, zinc finger protein 43
Зовнішні ІД OMIM: 603972 MGI: 3040691 HomoloGene: 128170 GeneCards: ZNF43
Шаблон експресії
PBB GE ZNF43 206695 x at fs.png

PBB GE ZNF43 217547 x at fs.png

PBB GE ZNF43 222136 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001001152
RefSeq (білок)
NP_001001152
Локус (UCSC) Хр. 19: 21.8 – 21.85 Mb Хр. 13: 67.25 – 67.28 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF43 (англ. Zinc finger protein 43) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 809 амінокислот, а молекулярна маса — 94 124[4].

Послідовність амінокислот
1020304050
MGPLTFMDVAIEFCLEEWQCLDIAQQNLYRNVMLENYRNLVFLGIAVSKP
DLITCLEQEKEPWEPMRRHEMVAKPPVMCSHFTQDFWPEQHIKDPFQKAT
LRRYKNCEHKNVHLKKDHKSVDECKVHRGGYNGFNQCLPATQSKIFLFDK
CVKAFHKFSNSNRHKISHTEKKLFKCKECGKSFCMLPHLAQHKIIHTRVN
FCKCEKCGKAFNCPSIITKHKRINTGEKPYTCEECGKVFNWSSRLTTHKK
NYTRYKLYKCEECGKAFNKSSILTTHKIIRTGEKFYKCKECAKAFNQSSN
LTEHKKIHPGEKPYKCEECGKAFNWPSTLTKHKRIHTGEKPYTCEECGKA
FNQFSNLTTHKRIHTAEKFYKCTECGEAFSRSSNLTKHKKIHTEKKPYKC
EECGKAFKWSSKLTEHKLTHTGEKPYKCEECGKAFNWPSTLTKHNRIHTG
EKPYKCEVCGKAFNQFSNLTTHKRIHTAEKPYKCEECGKAFSRSSNLTKH
KKIHIEKKPYKCEECGKAFKWSSKLTEHKITHTGEKPYKCEECGKAFNHF
SILTKHKRIHTGEKPYKCEECGKAFTQSSNLTTHKKIHTGEKFYKCEECG
KAFTQSSNLTTHKKIHTGGKPYKCEECGKAFNQFSTLTKHKIIHTEEKPY
KCEECGKAFKWSSTLTKHKIIHTGEKPYKCEECGKAFKLSSTLSTHKIIH
TGEKPYKCEKCGKAFNRSSNLIEHKKIHTGEQPYKCEECGKAFNYSSHLN
THKRIHTKEQPYKCKECGKAFNQYSNLTTHNKIHTGEKLYKPEDVTVILT
TPQTFSNIK

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Lovering R., Trowsdale J. (1991). A gene encoding 22 highly related zinc fingers is expressed in lymphoid cell lines.. Nucleic Acids Res. 19: 2921 — 2927.  PubMed DOI:10.1093/nar/19.11.2921
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bellefroid E.J., Poncelet D.A., Lecocq P.J., Revelant O., Martial J.A. (1991). The evolutionarily conserved Kruppel-associated box domain defines a subfamily of eukaryotic multifingered proteins.. Proc. Natl. Acad. Sci. U.S.A. 88: 3608 — 3612.  PubMed DOI:10.1073/pnas.88.9.3608
  • Thiesen H.-J. (1990). Multiple genes encoding zinc finger domains are expressed in human T cells.. New Biol. 2: 363 — 374.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13109 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P17038 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]