DDIT3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DDIT3
Ідентифікатори
Символи DDIT3, CEBPZ, CHOP, CHOP-10, CHOP10, GADD153, DNA damage-inducible transcript 3, DNA damage inducible transcript 3, C/EBPzeta, AltDDIT3
Зовнішні ІД OMIM: 126337 MGI: 109247 HomoloGene: 3012 GeneCards: DDIT3
Шаблон експресії
PBB GE DDIT3 209383 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001290183
NM_007837
RefSeq (білок)
NP_001277112
NP_031863
Локус (UCSC) Хр. 12: 57.52 – 57.52 Mb Хр. 10: 127.29 – 127.3 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

DDIT3 (англ. DNA damage inducible transcript 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 169 амінокислот, а молекулярна маса — 19 175[4].

Послідовність амінокислот
1020304050
MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESK
IFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQG
RTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTR
EVEATRRALIDRMVNLHQA

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як апоптоз, відповідь на стрес, транскрипція, регуляція транскрипції, відповідь на порушення конформації білку, клітинний цикл, сигнальний шлях Wnt, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Crozat A., Aman P., Mandahl N., Ron D. (1993). Fusion of CHOP to a novel RNA-binding protein in human myxoid liposarcoma.. Nature 363: 640 — 644.  PubMed DOI:10.1038/363640a0
  • Rabbitts T.H., Forster A., Larson R., Nathan P. (1993). Fusion of the dominant negative transcription regulator CHOP with a novel gene FUS by translocation t(12;16) in malignant liposarcoma.. Nat. Genet. 4: 175 — 180.  PubMed DOI:10.1038/ng0693-175
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Oyadomari S., Mori M. (2004). Roles of CHOP/GADD153 in endoplasmic reticulum stress.. Cell Death Differ. 11: 381 — 389.  PubMed DOI:10.1038/sj.cdd.4401373
  • Yamaguchi H., Wang H.G. (2004). CHOP is involved in endoplasmic reticulum stress-induced apoptosis by enhancing DR5 expression in human carcinoma cells.. J. Biol. Chem. 279: 45495 — 45502.  PubMed DOI:10.1074/jbc.M406933200
  • Ohoka N., Yoshii S., Hattori T., Onozaki K., Hayashi H. (2005). TRB3, a novel ER stress-inducible gene, is induced via ATF4-CHOP pathway and is involved in cell death.. EMBO J. 24: 1243 — 1255.  PubMed DOI:10.1038/sj.emboj.7600596

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2726 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P35638 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]