MYCL

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MYCL
Ідентифікатори
Символи MYCL, LMYC, MYCL1, bHLHe38, L-Myc, v-myc avian myelocytomatosis viral oncogene lung carcinoma derived homolog, MYCL proto-oncogene, bHLH transcription factor
Зовнішні ІД OMIM: 164850 MGI: 96799 HomoloGene: 3921 GeneCards: MYCL
Шаблон експресії
PBB GE MYCL1 214058 at fs.png

PBB GE MYCL1 215491 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005376
NM_001033081
NM_001033082
NM_008506
NM_001303121
RefSeq (білок)
NP_001028253
NP_001028254
NP_005367
NP_001290050
NP_032532
Локус (UCSC) Хр. 1: 39.9 – 39.9 Mb Хр. 4: 123 – 123 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MYCL (англ. MYCL proto-oncogene, bHLH transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 364 амінокислот, а молекулярна маса — 40 327[4].

Послідовність амінокислот
1020304050
MDYDSYQHYFYDYDCGEDFYRSTAPSEDIWKKFELVPSPPTSPPWGLGPG
AGDPAPGIGPPEPWPGGCTGDEAESRGHSKGWGRNYASIIRRDCMWSGFS
ARERLERAVSDRLAPGAPRGNPPKASAAPDCTPSLEAGNPAPAAPCPLGE
PKTQACSGSESPSDSENEEIDVVTVEKRQSLGIRKPVTITVRADPLDPCM
KHFHISIHQQQHNYAARFPPESCSQEEASERGPQEEVLERDAAGEKEDEE
DEEIVSPPPVESEAAQSCHPKPVSSDTEDVTKRKNHNFLERKRRNDLRSR
FLALRDQVPTLASCSKAPKVVILSKALEYLQALVGAEKRMATEKRQLRCR
QQQLQKRIAYLTGY

Задіяний у такому біологічному процесі як поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • DePinho R.A., Hatton K.S., Tesfaye A., Yancopoulos G.D., Alt F.W. (1987). The human myc gene family: structure and activity of L-myc and an L-myc pseudogene.. Genes Dev. 1: 1311 — 1326.  PubMed DOI:10.1101/gad.1.10.1311
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ikegaki N., Minna J., Kennett R.H. (1989). The human L-myc gene is expressed as two forms of protein in small cell lung carcinoma cell lines: detection by monoclonal antibodies specific to two myc homology box sequences.. EMBO J. 8: 1793 — 1799.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7555 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, P12524 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]