GTF2A1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF2A1
Protein GTF2A1 PDB 1nvp.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2A1, TF2A1, TFIIA, TFIIA-42, TFIIAL, general transcription factor IIA subunit 1
Зовнішні ІД OMIM: 600520 MGI: 1933277 HomoloGene: 56331 GeneCards: GTF2A1
Шаблон експресії
PBB GE GTF2A1 206521 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_201595
NM_001278940
NM_015859
NM_031391
NM_175335
RefSeq (білок)
NP_001265869
NP_056943
NP_963889
NP_113568
NP_780544
Локус (UCSC) Хр. 14: 81.18 – 81.22 Mb Хр. 12: 91.56 – 91.59 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF2A1 (англ. General transcription factor IIA subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 376 амінокислот, а молекулярна маса — 41 514[4].

Послідовність амінокислот
1020304050
MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKL
MQSRAVDGFHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQAQPQQTVPQQA
QTQQVLIPASQQATAPQVIVPDSKLIQHMNASNMSAAATAATLALPAGVT
PVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIPQMQPGGVQAP
VIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQI
TATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKE
KDGAEDGQVEEEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWK
FHLKDGIMNLNGRDYIFSKAIGDAEW

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Локалізований у ядрі.

Література[ред. | ред. код]

  • Dejong J., Roeder R.G. (1993). A single cDNA, hTFIIA/alpha, encodes both the p35 and p19 subunits of human TFIIA.. Genes Dev. 7: 2220 — 2234.  PubMed DOI:10.1101/gad.7.11.2220
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Mitsiou D.J., Stunnenberg H.G. (2000). TAC, a TBP-sans-TAFs complex containing the unprocessed TFIIAalphabeta precursor and the TFIIAgamma subunit.. Mol. Cell 6: 527 — 537.  PubMed DOI:10.1016/S1097-2765(00)00052-6
  • Solow S., Salunek M., Ryan R., Lieberman P.M. (2001). Taf(II) 250 phosphorylates human transcription factor IIA on serine residues important for TBP binding and transcription activity.. J. Biol. Chem. 276: 15886 — 15892.  PubMed DOI:10.1074/jbc.M009385200

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4646 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P52655 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]