IRF7

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IRF7
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IRF7, IRF-7H, IRF7A, IRF7B, IRF7C, IRF7H, IMD39, interferon regulatory factor 7, IRF-7
Зовнішні ІД OMIM: 605047 MGI: 1859212 HomoloGene: 128624 GeneCards: IRF7
Шаблон експресії
PBB GE IRF7 208436 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001572
NM_004029
NM_004030
NM_004031
NM_001252600
NM_001252601
NM_016850
RefSeq (білок)
NP_001563
NP_004020
NP_004022
NP_001239529
NP_001239530
NP_058546
Локус (UCSC) Хр. 11: 0.61 – 0.62 Mb Хр. 7: 141.26 – 141.27 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IRF7 (англ. Interferon regulatory factor 7) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 503 амінокислот, а молекулярна маса — 54 278[4].

Послідовність амінокислот
1020304050
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARK
DLSEADARIFKAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALR
STRRFVMLRDNSGDPADPHKVYALSRELCWREGPGTDQTEAEAPAAVPPP
QGGPPGPFLAHTHAGLQAPGPLPAPAGDKGDLLLQAVQQSCLADHLLTAS
WGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAVETTPSPGPQP
AALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELL
RHVAPGLHLELRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNC
DTPIFDFRVFFQELVEFRARQRRGSPRYTIYLGFGQDLSAGRPKEKSLVL
VKLEPWLCRVHLEGTQREGVSSLDSSSLSLCLSSANSLYDDIECFLMELE
QPA

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як імунітет, вроджений імунітет, взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, противірусний захист, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Zhang L., Pagano J.S. (1997). IRF-7, a new interferon regulatory factor associated with Epstein-Barr virus latency.. Mol. Cell. Biol. 17: 5748 — 5757.  PubMed DOI:10.1128/MCB.17.10.5748
  • Au W.-C., Moore P.A., LaFleur D.W., Tombal B., Pitha P.M. (1998). Characterization of the interferon regulatory factor-7 and its potential role in the transcription activation of interferon A genes.. J. Biol. Chem. 273: 29210 — 29217.  PubMed DOI:10.1074/jbc.273.44.29210
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Marie I.J., Smith E., Prakash A., Levy D.E. (2000). Phosphorylation-induced dimerization of interferon regulatory factor 7 unmasks DNA binding and a bipartite transactivation domain.. Mol. Cell. Biol. 20: 8803 — 8814.  PubMed DOI:10.1128/MCB.20.23.8803-8814.2000
  • Smith E.J., Marie I.J., Prakash A., Garcia-Sastre A., Levy D.E. (2001). IRF3 and IRF7 phosphorylation in virus-infected cells does not require double-stranded RNA-dependent protein kinase R or Ikappa B kinase but is blocked by Vaccinia virus E3L protein.. J. Biol. Chem. 276: 8951 — 8957.  PubMed DOI:10.1074/jbc.M008717200
  • Zhang L., Pagano J.S. (2002). Structure and function of IRF-7.. J. Interferon Cytokine Res. 22: 95 — 101.  PubMed DOI:10.1089/107999002753452700

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6122 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q92985 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]