DLX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
DLX1
Ідентифікатори
Символи distal-less homeo box 1homeobox protein DLX-1DLX1
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

DLX1 (англ. Distal-less homeobox 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 255 амінокислот, а молекулярна маса — 27 320[2].

Послідовність амінокислот
1020304050
MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGH
SQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSR
LEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQT
QYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALA
NGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQ
QPQLM

Кодований геном білок за функціями належить до репресорів, активаторів, білків розвитку. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, диференціація, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:2914 (англ.). Процитовано 28 серпня 2017. 
  2. UniProt, P56177 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]