ZNF148

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF148
Ідентифікатори
Символи ZNF148, BERF-1, BFCOL1, HT-BETA, ZBP-89, ZFP148, pHZ-52, zinc finger protein 148
Зовнішні ІД OMIM: 601897 MGI: 1332234 HomoloGene: 8003 GeneCards: ZNF148
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021964
NM_011749
NM_001358569
NM_001358570
RefSeq (білок)
NP_035879
NP_001345498
NP_001345499
Локус (UCSC) н/д Хр. 16: 33.38 – 33.5 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF148 (англ. Zinc finger protein 148) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 794 амінокислот, а молекулярна маса — 88 976[4].

Послідовність амінокислот
1020304050
MNIDDKLEGLFLKCGGIDEMQSSRTMVVMGGVSGQSTVSGELQDSVLQDR
SMPHQEILAADEVLQESEMRQQDMISHDELMVHEETVKNDEEQMETHERL
PQGLQYALNVPISVKQEITFTDVSEQLMRDKKQIREPVDLQKKKKRKQRS
PAKILTINEDGSLGLKTPKSHVCEHCNAAFRTNYHLQRHVFIHTGEKPFQ
CSQCDMRFIQKYLLQRHEKIHTGEKPFRCDECGMRFIQKYHMERHKRTHS
GEKPYQCEYCLQYFSRTDRVLKHKRMCHENHDKKLNRCAIKGGLLTSEED
SGFSTSPKDNSLPKKKRQKTEKKSSGMDKESALDKSDLKKDKNDYLPLYS
SSTKVKDEYMVAEYAVEMPHSSVGGSHLEDASGEIHPPKLVLKKINSKRS
LKQPLEQNQTISPLSTYEESKVSKYAFELVDKQALLDSEGNADIDQVDNL
QEGPSKPVHSSTNYDDAMQFLKKKRYLQAASNNSREYALNVGTIASQPSV
TQAAVASVIDESTTASILESQALNVEIKSNHDKNVIPDEVLQTLLDHYSH
KANGQHEISFSVADTEVTSSISINSSEVPEVTPSENVGSSSQASSSDKAN
MLQEYSKFLQQALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQV
YATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASAT
STQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFST
ANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Law D.J., Tarle S.A., Merchant J.L. (1998). The human ZBP-89 homolog, located at chromosome 3q21, represses gastrin gene expression.. Mamm. Genome 9: 165 — 167.  PubMed DOI:10.1007/s003359900711
  • Ye S., Whatling C., Watkins H., Henney A. (1999). Human stromelysin gene promoter activity is modulated by transcription factor ZBP-89.. FEBS Lett. 450: 268 — 272.  PubMed DOI:10.1016/S0014-5793(99)00509-8
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:12933 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q9UQR1 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]