TAF2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF2, CIF150, MRT40, TAF2B, TAFII150, TATA-box binding protein associated factor 2
Зовнішні ІД OMIM: 604912 MGI: 2443028 HomoloGene: 31137 GeneCards: TAF2
Шаблон експресії
PBB GE TAF2 209523 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003184
NM_001081288
NM_177040
RefSeq (білок)
NP_003175
NP_001074757
Локус (UCSC) Хр. 8: 119.73 – 119.83 Mb Хр. 15: 55.02 – 55.07 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF2 (англ. TATA-box binding protein associated factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 8-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 199 амінокислот, а молекулярна маса — 136 971[4].

Послідовність амінокислот
1020304050
MPLTGVEPARMNRKKGDKGFESPRPYKLTHQVVCINNINFQRKSVVGFVE
LTIFPTVANLNRIKLNSKQCRIYRVRINDLEAAFIYNDPTLEVCHSESKQ
RNLNYFSNAYAAAVSAVDPDAGNGELCIKVPSELWKHVDELKVLKIHINF
SLDQPKGGLHFVVPSVEGSMAERGAHVFSCGYQNSTRFWFPCVDSYSELC
TWKLEFTVDAAMVAVSNGDLVETVYTHDMRKKTFHYMLTIPTAASNISLA
IGPFEILVDPYMHEVTHFCLPQLLPLLKHTTSYLHEVFEFYEEILTCRYP
YSCFKTVFIDEAYVEVAAYASMSIFSTNLLHSAMIIDETPLTRRCLAQSL
AQQFFGCFISRMSWSDEWVLKGISGYIYGLWMKKTFGVNEYRHWIKEELD
KIVAYELKTGGVLLHPIFGGGKEKDNPASHLHFSIKHPHTLSWEYYSMFQ
CKAHLVMRLIENRISMEFMLQVFNKLLSLASTASSQKFQSHMWSQMLVST
SGFLKSISNVSGKDIQPLIKQWVDQSGVVKFYGSFAFNRKRNVLELEIKQ
DYTSPGTQKYVGPLKVTVQELDGSFNHTLQIEENSLKHDIPCHSKSRRNK
KKKIPLMNGEEVDMDLSAMDADSPLLWIRIDPDMSVLRKVEFEQADFMWQ
YQLRYERDVVAQQESILALEKFPTPASRLALTDILEQEQCFYRVRMSACF
CLAKIANSMVSTWTGPPAMKSLFTRMFCCKSCPNIVKTNNFMSFQSYFLQ
KTMPVAMALLRDVHNLCPKEVLTFILDLIKYNDNRKNKFSDNYYRAEMID
ALANSVTPAVSVNNEVRTLDNLNPDVRLILEEITRFLNMEKLLPSYRHTI
TVSCLRAIRVLQKNGHVPSDPALFKSYAEYGHFVDIRIAALEAVVDYTKV
DRSYEELQWLLNMIQNDPVPYVRHKILNMLTKNPPFTKNMESPLCNEALV
DQLWKLMNSGTSHDWRLRCGAVDLYFTLFGLSRPSCLPLPELGLVLNLKE
KKAVLNPTIIPESVAGNQEAANNPSSHPQLVGFQNPFSSSQDEEEIDMDT
VHDSQAFISHHLNMLERPSTPGLSKYRPASSRSALIPQHSAGCDSTPTTK
PQWSLELARKGTGKEQAPLEMSMHPAASAPLSVFTKESTASKHSDHHHHH
HHEHKKKKKKHKHKHKHKHKHDSKEKDKEPFTFSSPASGRSIRSPSLSD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Локалізований у ядрі.

Література[ред. | ред. код]

  • Kaufmann J., Ahrens K., Koop R., Smale S.T., Muller R. (1998). CIF150, a human cofactor for transcription factor IID-dependent initiator function.. Mol. Cell. Biol. 18: 233 — 239.  PubMed DOI:10.1128/MCB.18.1.233
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cavusoglu N., Brand M., Tora L., van Dorsselaer A. (2003). Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.. Proteomics 3: 217 — 223.  PubMed DOI:10.1002/pmic.200390030

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11536 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q6P1X5 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]