ZNF19

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF19
Ідентифікатори
Символи ZNF19, KOX12, zinc finger protein 19
Зовнішні ІД OMIM: 194525 HomoloGene: 56009 GeneCards: ZNF19
Шаблон експресії
PBB GE ZNF19 gnf1h07815 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006961
н/д
RefSeq (білок)
NP_008892
н/д
Локус (UCSC) Хр. 16: 71.46 – 71.57 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF19 (англ. Zinc finger protein 19) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 458 амінокислот, а молекулярна маса — 52 449[3].

Послідовність амінокислот
1020304050
MAAMPLKAQYQEMVTFEDVAVHFTKTEWTGLSPAQRALYRSVMLENFGNL
TALGYPVPKPALISLLERGDMAWGLEAQDDPPAERTKNVCKDVETNIDSE
STLIQGISEERDGMMSHGQLKSVPQRTDFPETRNVEKHQDIPTVKNIQGK
VPRIPCARKPFICEECGKSFSYFSYYARHQRIHTGEKPFECSECGKAFNG
NSSLIRHQRIHTGERPYQCEECGRAFNDNANLIRHQRIHSGDRPYYCTEC
GNSFTSSSEFVIHQRIHTGEKPYECNECGKAFVGNSPLLRHQKIHTGEKP
YECNECGKSFGRTSHLSQHQRIHTGEKPYSCKVCGQAFNFHTKLTRHQRI
HSEEKPFDCVDCGKAFSAQEQLKRHLRIHTQESSYVCDECGKALTSKRNL
HQHQRIHTGEKPYECSKYEKAFGTSSQLGHLEHVYSGEKPVLDICRFGLP
EFFTPFYW

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Bray P.L., Lichter P., Thiesen H.-J., Ward D.C., Dawid I.B. (1991). Characterization and mapping of human genes encoding zinc finger proteins.. Proc. Natl. Acad. Sci. U.S.A. 88: 9563 — 9567.  PubMed DOI:10.1073/pnas.88.21.9563
  • Thiesen H.-J. (1990). Multiple genes encoding zinc finger domains are expressed in human T cells.. New Biol. 2: 363 — 374.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:12981 (англ.). Процитовано 11 вересня 2017. 
  3. UniProt, P17023 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]