ERV3-1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ERV3-1
Ідентифікатори
Символи ERV3-1, ERV-R, ERV3, ERVR, HERV-R, HERVR, envR, endogenous retrovirus group 3 member 1, endogenous retrovirus group 3 member 1, envelope
Зовнішні ІД OMIM: 131170 HomoloGene: 128310 GeneCards: ERV3-1
Шаблон експресії
PBB GE ERV3 gnf1h04728 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001007253
н/д
RefSeq (білок)
NP_001007254
н/д
Локус (UCSC) Хр. 7: 64.99 – 65.01 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ERV3-1 (англ. Endogenous retrovirus group 3 member 1, envelope) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 604 амінокислот, а молекулярна маса — 67 942[3].

Послідовність амінокислот
1020304050
MLGMNMLLITLFLLLPLSMLKGEPWEGCLHCTHTTWSGNIMTKTLLYHTY
YECAGTCLGTCTHNQTTYSVCDPGRGQPYVCYDPKSSPGTWFEIHVGSKE
GDLLNQTKVFPSGKDVVSLYFDVCQIVSMGSLFPVIFSSMEYYSSCHKNR
YAHPACSTDSPVTTCWDCTTWSTNQQSLGPIMLTKIPLEPDCKTSTCNSV
NLTILEPDQPIWTTGLKAPLGARVSGEEIGPGAYVYLYIIKKTRTRSTQQ
FRVFESFYEHVNQKLPEPPPLASNLFAQLAENIASSLHVASCYVCGGMNM
GDQWPWEARELMPQDNFTLTASSLEPAPSSQSIWFLKTSIIGKFCIARWG
KAFTDPVGELTCLGQQYYNETLGKTLWRGKSNNSESPHPSPFSRFPSLNH
SWYQLEAPNTWQAPSGLYWICGPQAYRQLPAKWSGACVLGTIRPSFFLMP
LKQGEALGYPIYDETKRKSKRGITIGDWKDNEWPPERIIQYYGPATWAED
GMWGYRTPVYMLNRIIRLQAVLEIITNETAGALNLLAQQATKMRNVIYQN
RLALDYLLAQEEGVCGKFNLTNCCLELDDEGKVIKEITAKIQKLAHIPVQ
TWKG

Література[ред. | ред. код]

  • Cohen M., Powers M., O'Connell C., Kato N. (1985). The nucleotide sequence of the env gene from the human provirus ERV3 and isolation and characterization of an ERV3-specific cDNA.. Virology 147: 449 — 458.  PubMed DOI:10.1016/0042-6822(85)90147-3
  • Venables P.J.W., Brookes S.M., Griffiths D., Weiss R.A., Boyd M.T. (1995). Abundance of an endogenous retroviral envelope protein in placental trophoblasts suggests a biological function.. Virology 211: 589 — 592.  PubMed DOI:10.1006/viro.1995.1442
  • Lin L., Xu B., Rote N.S. (2000). The cellular mechanism by which the human endogenous retrovirus ERV-3 env gene affects proliferation and differentiation in a human placental trophoblast model, BeWo.. Placenta 21: 73 — 78.  PubMed DOI:10.1053/plac.1999.0443
  • Blaise S., de Parseval N., Benit L., Heidmann T. (2003). Genomewide screening for fusogenic human endogenous retrovirus envelopes identifies syncytin 2, a gene conserved on primate evolution.. Proc. Natl. Acad. Sci. U.S.A. 100: 13013 — 13018.  PubMed DOI:10.1073/pnas.2132646100
  • de Parseval N., Lazar V., Casella J.-F., Benit L., Heidmann T. (2003). Survey of human genes of retroviral origin: identification and transcriptome of the genes with coding capacity for complete envelope proteins.. J. Virol. 77: 10414 — 10422.  PubMed DOI:10.1128/JVI.77.19.10414-10422.2003
  • Rasmussen H.B., Clausen J. (1998). Large number of polymorphic nucleotides and a termination codon in the env gene of the endogenous human retrovirus ERV3.. Dis. Markers 14: 127 — 133.  PubMed DOI:10.1155/1998/958379

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:3454 (англ.). Процитовано 7 вересня 2017. 
  3. UniProt, Q14264 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]