ZNF638

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF638
Ідентифікатори
Символи ZNF638, NP220, ZFML, Zfp638, zinc finger protein 638
Зовнішні ІД OMIM: 614349 MGI: 1203484 HomoloGene: 7447 GeneCards: ZNF638
Шаблон експресії
PBB GE ZNF638 211257 x at fs.png

PBB GE ZNF638 213775 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001014972
NM_001252612
NM_001252613
NM_014497
NM_001166371
NM_008717
NM_001355284
NM_001355285
NM_001355286
RefSeq (білок)
NP_001014972
NP_001239541
NP_001239542
NP_055312
NP_001159843
NP_032743
NP_001342213
NP_001342214
NP_001342215
Локус (UCSC) Хр. 2: 71.28 – 71.44 Mb Хр. 6: 83.87 – 83.99 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF638 (англ. Zinc finger protein 638) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 1 978 амінокислот, а молекулярна маса — 220 625[4].

Послідовність амінокислот
1020304050
MSRPRFNPRGDFPLQRPRAPNPSGMRPPGPFMRPGSMGLPRFYPAGRARG
IPHRFAGHESYQNMGPQRMNVQVTQHRTDPRLTKEKLDFHEAQQKKGKPH
GSRWDDEPHISASVAVKQSSVTQVTEQSPKVQSRYTKESASSILASFGLS
NEDLEELSRYPDEQLTPENMPLILRDIRMRKMGRRLPNLPSQSRNKETLG
SEAVSSNVIDYGHASKYGYTEDPLEVRIYDPEIPTDEVENEFQSQQNISA
SVPNPNVICNSMFPVEDVFRQMDFPGESSNNRSFFSVESGTKMSGLHISG
GQSVLEPIKSVNQSINQTVSQTMSQSLIPPSMNQQPFSSELISSVSQQER
IPHEPVINSSNVHVGSRGSKKNYQSQADIPIRSPFGIVKASWLPKFSHAD
AQKMKRLPTPSMMNDYYAASPRIFPHLCSLCNVECSHLKDWIQHQNTSTH
IESCRQLRQQYPDWNPEILPSRRNEGNRKENETPRRRSHSPSPRRSRRSS
SSHRFRRSRSPMHYMYRPRSRSPRICHRFISRYRSRSRSRSPYRIRNPFR
GSPKCFRSVSPERMSRRSVRSSDRKKALEDVVQRSGHGTEFNKQKHLEAA
DKGHSPAQKPKTSSGTKPSVKPTSATKSDSNLGGHSIRCKSKNLEDDTLS
ECKQVSDKAVSLQRKLRKEQSLHYGSVLLITELPEDGCTEEDVRKLFQPF
GKVNDVLIVPYRKEAYLEMEFKEAITAIMKYIETTPLTIKGKSVKICVPG
KKKAQNKEVKKKTLESKKVSASTLKRDADASKAVEIVTSTSAAKTGQAKA
SVAKVNKSTGKSASSVKSVVTVAVKGNKASIKTAKSGGKKSLEAKKTGNV
KNKDSNKPVTIPENSEIKTSIEVKATENCAKEAISDAALEATENEPLNKE
TEEMCVMLVSNLPNKGYSVEEVYDLAKPFGGLKDILILSSHKKAYIEINR
KAAESMVKFYTCFPVLMDGNQLSISMAPENMNIKDEEAIFITLVKENDPE
ANIDTIYDRFVHLDNLPEDGLQCVLCVGLQFGKVDHHVFISNRNKAILQL
DSPESAQSMYSFLKQNPQNIGDHMLTCSLSPKIDLPEVQIEHDPELEKES
PGLKNSPIDESEVQTATDSPSVKPNELEEESTPSIQTETLVQQEEPCEEE
AEKATCDSDFAVETLELETQGEEVKEEIPLVASASVSIEQFTENAEECAL
NQQMFNSDLEKKGAEIINPKTALLPSDSVFAEERNLKGILEESPSEAEDF
ISGITQTMVEAVAEVEKNETVSEILPSTCIVTLVPGIPTGDEKTVDKKNI
SEKKGNMDEKEEKEFNTKETRMDLQIGTEKAEKNEGRMDAEKVEKMAAMK
EKPAENTLFKAYPNKGVGQANKPDETSKTSILAVSDVSSSKPSIKAVIVS
SPKAKATVSKTENQKSFPKSVPRDQINAEKKLSAKEFGLLKPTSARSGLA
ESSSKFKPTQSSLTRGGSGRISALQGKLSKLDYRDITKQSQETEARPSIM
KRDDSNNKTLAEQNTKNPKSTTGRSSKSKEEPLFPFNLDEFVTVDEVIEE
VNPSQAKQNPLKGKRKETLKNVPFSELNLKKKKGKTSTPRGVEGELSFVT
LDEIGEEEDAAAHLAQALVTVDEVIDEEELNMEEMVKNSNSLFTLDELID
QDDCISHSEPKDVTVLSVAEEQDLLKQERLVTVDEIGEVEELPLNESADI
TFATLNTKGNEGDTVRDSIGFISSQVPEDPSTLVTVDEIQDDSSDLHLVT
LDEVTEEDEDSLADFNNLKEELNFVTVDEVGEEEDGDNDLKVELAQSKND
HPTDKKGNRKKRAVDTKKTKLESLSQVGPVNENVMEEDLKTMIERHLTAK
TPTKRVRIGKTLPSEKAVVTEPAKGEEAFQMSEVDEESGLKDSEPERKRK
KTEDSSSGKSVASDVPEELDFLVPKAGFFCPICSLFYSGEKAMTNHCKST
RHKQNTEKFMAKQRKEKEQNEAEERSSR

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК, РНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:17894 (англ.). Процитовано 29 серпня 2017. 
  4. UniProt, Q14966 (англ.). Процитовано 29 серпня 2017. 

Див. також[ред. | ред. код]