NEUROG3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NEUROG3
Ідентифікатори
Символи bHLHa7neurogenin-3NEUROG3class A basic helix-loop-helix protein 7protein atonal homolog 5
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

NEUROG3 (англ. Neurogenin 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 214 амінокислот, а молекулярна маса — 23 077[2].

Послідовність амінокислот
1020304050
MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAE
EGGCRGAPRKLRARRGGRSRPKSELALSKQRRSRRKKANDRERNRMHNLN
SALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLRIADHSLYALE
PPAPHCGELGSPGGSPGDWGSLYSPVSQAGSLSPAASLEERPGLLGATFS
ACLSPGSLAFSDFL

Кодований геном білок за функціями належить до активаторів, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, нейрогенез. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:13806 (англ.). Процитовано 8 вересня 2017. 
  2. UniProt, Q9Y4Z2 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]