PITX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PITX1
Protein PITX1 PDB 1yz8.png
Ідентифікатори
Символи PITX1, BFT, CCF, LBNBG, POTX, PTX1, paired like homeodomain 1
Зовнішні ІД OMIM: 602149 MGI: 107374 HomoloGene: 20584 GeneCards: PITX1
Пов'язані генетичні захворювання
Клишоногість, Liebenberg syndrome[1]
Шаблон експресії
PBB GE PITX1 208502 s at fs.png

PBB GE PITX1 209587 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002653
NM_011097
RefSeq (білок)
NP_002644
NP_035227
Локус (UCSC) Хр. 5: 135.03 – 135.03 Mb Хр. 13: 55.83 – 55.84 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PITX1 (англ. Paired like homeodomain 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 314 амінокислот, а молекулярна маса — 34 128[5].

Послідовність амінокислот
1020304050
MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASES
SDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQ
LQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERN
QQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFT
FFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTG
SSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGL
QGPASGLNACQYNS

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Shang J., Li X., Ring H.Z., Clayton D.A., Francke U. (1997). Backfoot, a novel homeobox gene, maps to human chromosome 5 (BFT) and mouse chromosome 13 (Bft).. Genomics 40: 108 — 113.  PubMed DOI:10.1006/geno.1996.4558
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]