BBX

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BBX
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BBX, ARTC1, HBP2, HSPC339, MDS001, bobby sox homolog (Drosophila), HMG-box containing
Зовнішні ІД MGI: 1917758 HomoloGene: 10634 GeneCards: BBX
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001142568
NM_001276286
NM_020235
NM_027444
NM_001347240
RefSeq (білок)
NP_001136040
NP_001263215
NP_064620
NP_001334169
NP_081720
Локус (UCSC) Хр. 3: 107.52 – 107.81 Mb Хр. 16: 50.19 – 50.43 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BBX (англ. BBX, HMG-box containing) — білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 941 амінокислот, а молекулярна маса — 105 130[4].

Послідовність амінокислот
1020304050
MKGSNRNKDHSAEGEGVGKRPKRKCLQWHPLLAKKLLDFSEEEEEEDEEE
DIDKVQLLGADGLEQDVGETEDDESPEQRARRPMNAFLLFCKRHRSLVRQ
EHPRLDNRGATKILADWWAVLDPKEKQKYTDMAKEYKDAFMKANPGYKWC
PTTNKPVKSPTPTVNPRKKLWAFPSDSSRDLPSPKKAKTEEMPQLNFGMA
DPTQMGGLSMLLLAGEHALGTPEVSSGTCRPDVSESPELRQKSPLFQFAE
ISSSTSHSDASTKQCQTSALFQFAEISSNTSQLGGAEPVKRCGKSALFQL
AEMCLASEGMKMEESKLIKAKESDGGRIKELEKGKEEKEIKMEKTDETRL
QKEAEFEKSAKENLRDSKELRNFEALQIDDIMAIKMEDPKEIRKEELEED
HKCSHFPDFSYSASSKIIISDVPSRKDHMCHPHGIMIIEDPAALNKPEKL
KKKKKKSKMDRHGNDKSTPKKTCKKRQSSESDIESVIYTIEAVAKGDWGI
EKLGDTPRKKVRTSSSGKGSILDAKPPKKKVKSREKKMSKEKSSDTTKES
RPPDFISISASKNISGETPEGIKAEPLTPMEDALPPSLSGQAKPEDSDCH
RKIETCGSRKSERSCKGALYKTLVSEGMLTSLRANVDRGKRSSGKGNSSD
HEGCWNEESWTFSQSGTSGSKKFKKTKPKEDCLLGSAKLDEEFEKKFNSL
PQYSPVTFDRKCVPVPRKKKKTGNVSSEPTKTSKGPFQSQKKNLFHKIVS
KYKHKKEKPNVPEKGSGDKWSNKQLFLDAIHPTEAIFSEDRNTMEPVHKV
KNIPSIFNTPEPTTTQEPLVGSQKRKARKTKITHLVRTADGRVSPAGGTL
DDKPKEQLQRSLPKATETDCNDKCSHNTEVGETRSSTPEMPAVSAFFSLA
ALAEVAAMENVHRGQRSTPLTHDGQPKEMPQAPVLISCADQ

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Sanchez-Diaz A., Blanco M.A., Jones N., Moreno S. (2001). HBP2: a new mammalian protein that complements the fission yeast MBF transcription complex.. Curr. Genet. 40: 110 — 118.  PubMed DOI:10.1007/s002940100241
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:14422 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q8WY36 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]