SMAD2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SMAD2
Protein SMAD2 PDB 1dev.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SMAD2, JV18, JV18-1, MADH2, MADR2, hMAD-2, hSMAD family member 2
Зовнішні ІД OMIM: 601366 MGI: 108051 HomoloGene: 21197 GeneCards: SMAD2
Шаблон експресії
PBB GE SMAD2 203075 at fs.png

PBB GE SMAD2 203076 s at fs.png

PBB GE SMAD2 203077 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001003652
NM_001135937
NM_005901
NM_001252481
NM_010754
NM_001311070
RefSeq (білок)
NP_001003652
NP_001129409
NP_005892
NP_001239410
NP_001297999
NP_034884
Локус (UCSC) Хр. 18: 47.81 – 47.93 Mb Хр. 18: 76.24 – 76.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SMAD2 (англ. SMAD family member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 467 амінокислот, а молекулярна маса — 52 306[4].

Послідовність амінокислот
1020304050
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVK
KLKKTGRLDELEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTG
LYSFSEQTRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELKAIENCE
YAFNLKKDEVCVNPYHYQRVETPVLPPVLVPRHTEILTELPPLDDYTHSI
PENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQSMDTGSPAELS
PTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECL
SDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQ
GFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLD
KVLTQMGSPSVRCSSMS

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Zhang Y., Feng X.-H., Wu R.-Y., Derynck R. (1996). Receptor-associated Mad homologues synergize as effectors of the TGF-beta response.. Nature 383: 168 — 172.  PubMed DOI:10.1038/383168a0
  • Liu F., Pouponnot C., Massague J. (1997). Dual role of the Smad4/DPC4 tumor suppressor in TGFbeta-inducible transcriptional complexes.. Genes Dev. 11: 3157 — 3167.  PubMed DOI:10.1101/gad.11.23.3157
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tsukazaki T., Chiang T.A., Davison A.F., Attisano L., Wrana J.L. (1998). SARA, a FYVE domain protein that recruits Smad2 to the TGFbeta receptor.. Cell 95: 779 — 791.  PubMed DOI:10.1016/S0092-8674(00)81701-8
  • Kawabata M., Inoue H., Hanyu A., Imamura T., Miyazono K. (1998). Smad proteins exist as monomers in vivo and undergo homo- and hetero-oligomerization upon activation by serine/threonine kinase receptors.. EMBO J. 17: 4056 — 4065.  PubMed DOI:10.1093/emboj/17.14.4056
  • Kretzschmar M., Liu F., Hata A., Doody J., Massague J. (1997). The TGF-beta family mediator Smad1 is phosphorylated directly and activated functionally by the BMP receptor kinase.. Genes Dev. 11: 984 — 995.  PubMed DOI:10.1101/gad.11.8.984

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6768 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q15796 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]