TCF3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TCF3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TCF3, E2A, E47, ITF1, TCF-3, VDIR, bHLHb21, AGM8, transcription factor 3, p75
Зовнішні ІД OMIM: 147141 MGI: 98510 HomoloGene: 2408 GeneCards: TCF3
Пов'язані генетичні захворювання
Лімфогранулематоз[1]
Шаблон експресії
PBB GE TCF3 209153 s at fs.png

PBB GE TCF3 209151 x at fs.png

PBB GE TCF3 209152 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001136139
NM_003200
NM_001351778
NM_001351779
RefSeq (білок)
NP_001129611
NP_003191
NP_001338707
NP_001338708
Локус (UCSC) Хр. 19: 1.61 – 1.65 Mb Хр. 10: 80.41 – 80.43 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TCF3 (англ. Transcription factor 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 654 амінокислот, а молекулярна маса — 67 600[5].

Послідовність амінокислот
1020304050
MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL
EDRPSSGSWGSGDQSSSSFDPSRTFSEGTHFTESHSSLSSSTFLGPGLGG
KSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSPSGMKGTSQYY
PSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAY
PSAKTPSSTYPAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLP
PGSGPVGSSGSSSTFGGLHQHERMGYQLHGAEVNGGLPSASSFSSAPGAT
YGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFS
SSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEA
IHVLRSHAVGTAGDMHTLLPGHGALASGFTGPMSLGGRHAGLVGGSHPED
GLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKRE
EKEDEENTSAADHSEEEKKELKAPRARTSPDEDEDDLLPPEQKAEREKER
RVANNARERLRVRDINEAFKELGRMCQLHLNSEKPQTKLLILHQAVSVIL
NLEQQVRERNLNPKAACLKRREEEKVSGVVGDPQMVLSAPHPGLSEAHNP
AGHM

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, нейрогенез, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Kamps M.P., Murre C., Sun X.-H., Baltimore D. (1990). A new homeobox gene contributes the DNA binding domain of the t(1;19) translocation protein in pre-B ALL.. Cell 60: 547 — 555.  PubMed DOI:10.1016/0092-8674(90)90658-2
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Murre C., McCaw P.S., Baltimore D. (1989). A new DNA binding and dimerization motif in immunoglobulin enhancer binding, daughterless, MyoD, and myc proteins.. Cell 56: 777 — 783.  PubMed DOI:10.1016/0092-8674(89)90682-X
  • Henthorn P., McCarrick-Walmsley R., Kadesch T. (1990). Sequence of the cDNA encoding ITF-1, a positive-acting transcription factor.. Nucleic Acids Res. 18: 677 — 677.  PubMed DOI:10.1093/nar/18.3.677
  • Zhang Y., Bina M. (1991). Sequence of a HeLa cDNA provides the DNA binding domain and carboxy terminus of HE47: a human helix-loop-helix protein related to the enhancer binding factor E47.. DNA Seq. 2: 197 — 202.  PubMed DOI:10.3109/10425179109039690
  • Henthorn P., Kiledjian M., Kadesch T. (1990). Two distinct transcription factors that bind the immunoglobulin enhancer microE5/kappa 2 motif.. Science 247: 467 — 470.  PubMed DOI:10.1126/science.2105528

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]