ZNF35

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF35
Ідентифікатори
Символи ZNF35, HF.10, HF10, Zfp105, zinc finger protein 35
Зовнішні ІД OMIM: 194533 MGI: 1277119 HomoloGene: 2568 GeneCards: ZNF35
Шаблон експресії
PBB GE ZNF35 206096 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003420
NM_009544
RefSeq (білок)
NP_003411
н/д
Локус (UCSC) Хр. 3: 44.65 – 44.66 Mb Хр. 9: 122.92 – 122.93 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF35 (англ. Zinc finger protein 35) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 527 амінокислот, а молекулярна маса — 59 089[4].

Послідовність амінокислот
1020304050
MTAELREAMALAPWGPVKVKKEEEEEENFPGQASSQQVHSENIKVWAPVQ
GLQTGLDGSEEEEKGQNISWDMAVVLKATQEAPAASTLGSYSLPGTLAKS
EILETHGTMNFLGAETKNLQLLVPKTEICEEAEKPLIISERIQKADPQGP
ELGEACEKGNMLKRQRIKREKKDFRQVIVNDCHLPESFKEEENQKCKKSG
GKYSLNSGAVKNPKTQLGQKPFTCSVCGKGFSQSANLVVHQRIHTGEKPF
ECHECGKAFIQSANLVVHQRIHTGQKPYVCSKCGKAFTQSSNLTVHQKIH
SLEKTFKCNECEKAFSYSSQLARHQKVHITEKCYECNECGKTFTRSSNLI
VHQRIHTGEKPFACNDCGKAFTQSANLIVHQRSHTGEKPYECKECGKAFS
CFSHLIVHQRIHTAEKPYDCSECGKAFSQLSCLIVHQRIHSGDLPYVCNE
CGKAFTCSSYLLIHQRIHNGEKPYTCNECGKAFRQRSSLTVHQRTHTGEK
PYECEKCGAAFISNSHLMRHHRTHLVE

Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13099 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P13682 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]