HIF3A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HIF3A
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HIF3A, HIF-3A, IPAS, MOP7, PASD7, bHLHe17, HIF3-alpha-1, hypoxia inducible factor 3 alpha subunit, hypoxia inducible factor 3 subunit alpha
Зовнішні ІД OMIM: 609976 MGI: 1859778 HomoloGene: 9646 GeneCards: HIF3A
Шаблон експресії
PBB GE HIF3A 222123 s at fs.png

PBB GE HIF3A 219319 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_022462
NM_152794
NM_152795
NM_152796
NM_001162950
NM_016868
RefSeq (білок)
NP_071907
NP_690007
NP_690008
NP_690009
NP_001156422
NP_058564
Локус (UCSC) Хр. 19: 46.3 – 46.34 Mb Хр. 7: 17.03 – 17.06 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

[3]HIF3A (англ. Hypoxia inducible factor 3 alpha subunit, укр. фактор, що індукується гіпоксію 3, альфа субодиниця) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 669 амінокислот, а молекулярна маса — 72 433[5].

Послідовність амінокислот
1020304050
MALGLQRARSTTELRKEKSRDAARSRRSQETEVLYQLAHTLPFARGVSAH
LDKASIMRLTISYLRMHRLCAAGEWNQVGAGGEPLDACYLKALEGFVMVL
TAEGDMAYLSENVSKHLGLSQLELIGHSIFDFIHPCDQEELQDALTPQQT
LSRRKVEAPTERCFSLRMKSTLTSRGRTLNLKAATWKVLNCSGHMRAYKP
PAQTSPAGSPDSEPPLQCLVLICEAIPHPGSLEPPLGRGAFLSRHSLDMK
FTYCDDRIAEVAGYSPDDLIGCSAYEYIHALDSDAVSKSIHTLLSKGQAV
TGQYRFLARSGGYLWTQTQATVVSGGRGPQSESIVCVHFLISQVEETGVV
LSLEQTEQHSRRPIQRGAPSQKDTPNPGDSLDTPGPRILAFLHPPSLSEA
ALAADPRRFCSPDLRRLLGPILDGASVAATPSTPLATRHPQSPLSADLPD
ELPVGTENVHRLFTSGKDTEAVETDLDIAQDADALDLEMLAPYISMDDDF
QLNASEQLPRAYHRPLGAVPRPRARSFHGLSPPALEPSLLPRWGSDPRLS
CSSPSRGDPSASSPMAGARKRTLAQSSEDEDEGVELLGVRPPKRSPSPEH
ENFLLFPLSLSFLLTGGPAPGSLQDPSTPLLNLNEPLGLGPSLLSPYSDE
DTTQPGGPFQPRAGSAQAD

Кодований геном білок за функціями належить до репресорів, білків розвитку. Задіяний у таких біологічних процесах, як апоптоз, відповідь на стрес, транскрипція, регуляція транскрипції, ангіогенез, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі, мітохондрії.

Структура[ред. | ред. код]

Будь-які тварини, від ссавців до комах, мають спільний механізм, котрий пов'язує чутливість до змін парціального рівня кисневого тиску (pO2) із змінами регуляції транскрипції.

Усі HIF є членами родини білків bHLH/PAS, що містять один N-кінцевий домен базової basic-helix–loop–helix (bHLH) і два домени Per-ARNT-Sim (PAS), які є посередниками зв'язування та димеризації ДНК відповідно. Киснезалежний домен деградації “oxygen-dependent degradation domain” (ODDD) присутній тільки в ізоформах HIFa та контролює стабільність протеїну. N-кінцевий трансактиваційний домен (NTAD), у ізоформах HIFa та C-кінцевий трансактиваційний домен (англ. C-terminal transactivation domai”, CTAD), як в ізоформах HIFa, так і HIFb, сприяють активації гена-мішені .

HIF3a спочатку ідентифікували як член родини білків bHLH-PAS у мишей групи Gu. Вони клонували комплементарну ДНК, яка кодує поліпептид 662-амінокислоти з ідентифікацією амінокислотної послідовності до HIF1a та HIF2a (відповідно 57% та 53%) розташованих на N-кінці bHLH-PAS домена. C-кінець цієї молекули представлено ​​36-амінокислотною послідовністю, котра на 61% подібна до HIF1a ODDD.

Унікальні структурні особливості HIF3a включають наявність одного гідроксильованого проліну у киснезалежної ділянки розщеплення (oxygen-dependent degradation domain) ODDD та домену лейцинової блискавки[en] (LZIP), який бере участь у взаємодії білків-протеїнів, замість CTAD (C- термінальний транзактиваційний домен) на C-кінці молекули.

Як і HIF1a та HIF2a, HIF3a здатен димеризуватися з субодиницею HIFb, в результаті гетеродимер детектує елемент відповіді гіпоксії HRE (англ. hypoxia response element) на промоторі генів-мішеней. Крім того, взаємодія HIF3a-HIFb відбувається in vivo, де активність HIF3a регулюється внаслідок низького кисневого рівня тиску та CoCl2, агент, що імітує гіпоксію.

кДНК HIF3a людини була потім клонована, а 667-амінокислотна послідовність цієї молекули була на 81,9% гомологічною та структурно подібною до HIF3a миші.

Геномна організація локусу HIF3a включає в себе змінну кількість екзонів залежно від виду. Зокрема, локус миші в хромосомі 7 складається з 18 екзонів. Два екзони (1 і 1а) містять альтернативні стартові сайти. Аналогічним чином, локус людини в хромосомі 19 складається з 19 екзонів, а в екзонах 1a, 1b та ​​1c розташовані три альтернативних стартових сайта.

Структура субодиниці: Ізоформа-2 взаємодіє (через ODD-домен) з VHL (через бета-домен). Ізоформа-3 взаємодіє з HIF1A; взаємодія пригнічує зв'язування HIF1A з гіпоксично-реактивним елементом (HRE) та HIF1A / ARNT-залежною активацією транскрипції. Ізоформа-4 взаємодіє з ARNT; взаємодія відбувається залежною від HIF1A- та ДНК-зв'язувальністю і не викликає HIF1A / ARNT-залежну активацію транскрипції (PubMed: 16126907). Ізоформа-5 взаємодіє з EPAS1. Взаємодіє з BAD, BCL2L2 та MCL1.

Функції[ред. | ред. код]

Білок, кодований цим геном, є альфа-3 субодиницею одного з декількох альфа/бета-субодиниць гетеродимерних транскрипційних факторів, які регулюють багато адаптивних реакцій на низьку концентрацію кисню (гіпоксії). Альфа-3-субодиниця не має домену трансактивації, на відміну від альфа-1 або альфа-2 субодиниці. Вважається, що фактори, що містять альфа-3-субодиницю, є негативними регуляторами експресії генів індукованих гіпоксією. Для HIF3A гена вже знайдено декілька варіантів альтернативного сплайсингу.

Діє як регулятор гіпоксично-індукованої експресії генів. Виконує свою функцію як інгібітор ангіогенезу в гіпоксичних клітинах рогівки. Грає роль у розвитку кардіореспіраторної системи. Може також бути залученим до апоптозу.

Ізоформа 2: Знижує здатність транскрипційного фактора HIF1A зв'язуватися з гіпоксичними реактивними елементами (HRE), котрі локалізовані в межах енхансеру/промотора генів, що індукуються гіпоксією, таким чином інгібує HRE-керовану транскрипційну активацію.

Ізоформа 3: Знижує здатність транскрипційного фактора HIF1A зв'язуватися з елементами, що реагують на гіпоксію (HRE), котрі локалізовані в межах енхансеру/промотора генів, що індукують гіпоксією, таким чином інгібує HRE-керовану транскрипційну активацію.

ізоформа 4: Знижує здатність транскрипційного фактора HIF1A та EPAS1 / HIF2A зв'язуватися з елементами, що реагують на гіпоксію (HRE), розташованих в межах енхансеру/промотора генів, що індукуються гіпоксією, пригнічуючи HRE-керовану транскрипційну активацію. Може виступати як супресор пухлин, пригнічувати злоякісні трансформації клітин.

Ізоформа 5: Знижує здатність транскрипційного фактора HIF1A зв'язуватися з елементами, що реагують на гіпоксію (HRE), локалізованих в межах енхансера/промотора генів, що індуковани гіпоксією,інгібує транскрипційну активацію, керовану HRE.

Література[ред. | ред. код]

Hara S., Hamada J., Kobayashi C., Kondo Y., Imura N. (2001). Expression and characterization of hypoxia-inducible factor (HIF)-3alpha in human kidney: suppression of HIF-mediated gene expression by HIF-3alpha.. Biochem. Biophys. Res. Commun. 287: 808 — 813. 

Ravenna, L., Salvatori, L. and Russo, M. A. (2016), HIF3α: the little we know. FEBS J, 283: 993–1003. doi:10.1111/febs.13572 PubMed DOI:10.1006/bbrc.2001.5659

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Li Q.F., Wang X.R., Yang Y.W., Lin H. (2006). Hypoxia upregulates hypoxia inducible factor (HIF)-3alpha expression in lung epithelial cells: characterization and comparison with HIF-1alpha.. Cell Res. 16: 548 — 558.  PubMed DOI:10.1038/sj.cr.7310072
  • Tanaka T., Wiesener M., Bernhardt W., Eckardt K.U., Warnecke C. (2009). The human HIF (hypoxia-inducible factor)-3alpha gene is a HIF-1 target gene and may modulate hypoxic gene induction.. Biochem. J. 424: 143 — 151.  PubMed DOI:10.1042/BJ20090120
  • Augstein A., Poitz D.M., Braun-Dullaeus R.C., Strasser R.H., Schmeisser A. (2011). Cell-specific and hypoxia-dependent regulation of human HIF-3alpha: inhibition of the expression of HIF target genes in vascular cells.. Cell. Mol. Life Sci. 68: 2627 — 2642.  PubMed DOI:10.1007/s00018-010-0575-4

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HIF3A Symbol Report | HUGO Gene Nomenclature Committee. www.genenames.org. Архів оригіналу за 2018-01-07. Процитовано 2018-01-06. 
  4. HUGO Gene Nomenclature Commitee, HGNC:15825 (англ.). Процитовано 12 вересня 2017. 
  5. UniProt, Q9Y2N7 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]