GTF2H4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF2H4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2H4, general transcription factor IIH, polypeptide 4, 52kDa, P52, TFB2, TFIIH, general transcription factor IIH subunit 4
Зовнішні ІД OMIM: 601760 MGI: 1338799 HomoloGene: 7090 GeneCards: GTF2H4
Шаблон експресії
PBB GE GTF2H4 203577 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001517
NM_010364
RefSeq (білок)
NP_001508
NP_034494
Локус (UCSC) Хр. 6: 30.91 – 30.91 Mb Хр. 17: 35.67 – 35.67 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF2H4 (англ. General transcription factor IIH subunit 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 462 амінокислот, а молекулярна маса — 52 186[4].

Послідовність амінокислот
1020304050
MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPS
LAKNWVMRMLFLEQPLPQAAVALWVKKEFSKAQEESTGLLSGLRIWHTQL
LPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDKHARDVPSLDK
YAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAG
FQFLLLDTPAQLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYS
VEGMSDSLLNFLQHLREFGLVFQRKRKSRRYYPTRLAINLSSGVSGAGGT
VHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRES
VQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDR
LRFTEGVLYNQFLSQVDFELLLAHARELGVLVFENSAKRLMVVTPAGHSD
VKRFWKRQKHSS

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, пошкодження ДНК, репарація ДНК, альтернативний сплайсинг. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kershnar E., Wu S.-Y., Chiang C.-M. (1998). Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.. J. Biol. Chem. 273: 34444 — 34453.  PubMed DOI:10.1074/jbc.273.51.34444

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4658 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q92759 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]