ZNF281

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF281
Ідентифікатори
Символи ZNF281, ZBP-99, ZNP-99, zinc finger protein 281
Зовнішні ІД MGI: 3029290 HomoloGene: 8270 GeneCards: ZNF281
Шаблон експресії
PBB GE ZNF281 218401 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012482
NM_001281293
NM_001281294
NM_001160251
NM_177643
RefSeq (білок)
NP_001268222
NP_001268223
NP_036614
NP_001153723
NP_808311
Локус (UCSC) Хр. 1: 200.4 – 200.41 Mb Хр. 1: 136.62 – 136.63 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF281 (англ. Zinc finger protein 281) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 895 амінокислот, а молекулярна маса — 96 915[4].

Послідовність амінокислот
1020304050
MKIGSGFLSGGGGTGSSGGSGSGGGGSGGGGGGGSSGRRAEMEPTFPQGM
VMFNHRLPPVTSFTRPAGSAAPPPQCVLSSSTSAAPAAEPPPPPAPDMTF
KKEPAASAAAFPSQRTSWGFLQSLVSIKQEKPADPEEQQSHHHHHHHHYG
GLFAGAEERSPGLGGGEGGSHGVIQDLSILHQHVQQQPAQHHRDVLLSSS
SRTDDHHGTEEPKQDTNVKKAKRPKPESQGIKAKRKPSASSKPSLVGDGE
GAILSPSQKPHICDHCSAAFRSSYHLRRHVLIHTGERPFQCSQCSMGFIQ
KYLLQRHEKIHSREKPFGCDQCSMKFIQKYHMERHKRTHSGEKPYKCDTC
QQYFSRTDRLLKHRRTCGEVIVKGATSAEPGSSNHTNMGNLAVLSQGNTS
SSRRKTKSKSIAIENKEQKTGKTNESQISNNINMQSYSVEMPTVSSSGGI
IGTGIDELQKRVPKLIFKKGSRKNTDKNYLNFVSPLPDIVGQKSLSGKPS
GSLGIVSNNSVETIGLLQSTSGKQGQISSNYDDAMQFSKKRRYLPTASSN
SAFSINVGHMVSQQSVIQSAGVSVLDNEAPLSLIDSSALNAEIKSCHDKS
GIPDEVLQSILDQYSNKSESQKEDPFNIAEPRVDLHTSGEHSELVQEENL
SPGTQTPSNDKASMLQEYSKYLQQAFEKSTNASFTLGHGFQFVSLSSPLH
NHTLFPEKQIYTTSPLECGFGQSVTSVLPSSLPKPPFGMLFGSQPGLYLS
ALDATHQQLTPSQELDDLIDSQKNLETSSAFQSSSQKLTSQKEQKNLESS
TGFQIPSQELASQIDPQKDIEPRTTYQIENFAQAFGSQFKSGSRVPMTFI
TNSNGEVDHRVRTSVSDFSGYTNMMSDVSEPCSTRVKTPTSQSYR

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, диференціація, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Law D.J., Du M., Law G.L., Merchant J.L. (1999). ZBP-99 defines a conserved family of transcription factors and regulates ornithine decarboxylase gene expression.. Biochem. Biophys. Res. Commun. 262: 113 — 120.  PubMed DOI:10.1006/bbrc.1999.1180
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang X., Diab I.H., Zehner Z.E. (2003). ZBP-89 represses vimentin gene transcription by interacting with the transcriptional activator, Sp1.. Nucleic Acids Res. 31: 2900 — 2914.  PubMed DOI:10.1093/nar/gkg380
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13075 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q9Y2X9 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]