MLLT1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MLLT1
Ідентифікатори
Символи MLLT1, ENL, LTG19, YEATS1, myeloid/lymphoid or mixed-lineage leukemia; translocated to, 1, super elongation complex subunit, MLLT1 super elongation complex subunit
Зовнішні ІД OMIM: 159556 MGI: 1927238 HomoloGene: 4339 GeneCards: MLLT1
Шаблон експресії
PBB GE MLLT1 gnf1h01846 at fs.png

PBB GE MLLT1 214477 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005934
NM_022328
RefSeq (білок)
NP_005925
NP_071723
Локус (UCSC) Хр. 19: 6.21 – 6.28 Mb Хр. 17: 56.89 – 56.94 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MLLT1 (англ. MLLT1, super elongation complex subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 559 амінокислот, а молекулярна маса — 62 056[4].

Послідовність амінокислот
1020304050
MDNQCTVQVRLELGHRAQLRKKPTTEGFTHDWMVFVRGPEQCDIQHFVEK
VVFWLHDSFPKPRRVCKEPPYKVEESGYAGFIMPIEVHFKNKEEPRKVCF
TYDLFLNLEGNPPVNHLRCEKLTFNNPTTEFRYKLLRAGGVMVMPEGADT
VSRPSPDYPMLPTIPLSAFSDPKKTKPSHGSKDANKESSKTSKPHKVTKE
HRERPRKDSESKSSSKELEREQAKSSKDTSRKLGEGRLPKEEKAPPPKAA
FKEPKMALKETKLESTSPKGGPPPPPPPPPRASSKRPATADSPKPSAKKQ
KKSSSKGSRSAPGTSPRTSSSSSFSDKKPAKDKSSTRGEKVKAESEPREA
KKALEVEESNSEDEASFKSESAQSSPSNSSSSSDSSSDSDFEPSQNHSQG
PLRSMVEDLQSEESDEDDSSSGEEAAGKTNPGRDSRLSFSDSESDNSADS
SLPSREPPPPQKPPPPNSKVSGRRSPESCSKPEKILKKGTYDKAYTDELV
ELHRRLMALRERNVLQQIVNLIEETGHFNVTNTTFDFDLFSLDETTVRKL
QSCLEAVAT

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Локалізований у ядрі.

Література[ред. | ред. код]

  • Tkachuk D.C., Kohler S., Cleary M.L. (1992). Involvement of a homolog of Drosophila trithorax by 11q23 chromosomal translocations in acute leukemias.. Cell 71: 691 — 700.  PubMed DOI:10.1016/0092-8674(92)90602-9
  • Rubnitz J.E., Morrissey J., Savage P.A., Cleary M.L. (1994). ENL, the gene fused with HRX in t(11;19) leukemias, encodes a nuclear protein with transcriptional activation potential in lymphoid and myeloid cells.. Blood 84: 1747 — 1752.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7134 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q03111 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]