HIF1A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HIF1A
Protein HIF1A PDB 1h2k.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HIF1A, HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78, hypoxia inducible factor 1 alpha subunit, hypoxia inducible factor 1 subunit alpha, HIF-1α
Зовнішні ІД OMIM: 603348 MGI: 106918 HomoloGene: 1171 GeneCards: HIF1A
Шаблон експресії
PBB GE HIF1A 200989 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_181054
NM_001243084
NM_001530
NM_010431
NM_001313919
NM_001313920
RefSeq (білок)
NP_001230013
NP_001521
NP_851397
NP_001521.1
NP_001300848
NP_001300849
NP_034561
Локус (UCSC) Хр. 14: 61.7 – 61.75 Mb Хр. 12: 73.9 – 73.95 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HIF1A (англ. Hypoxia inducible factor 1 alpha subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 826 амінокислот, а молекулярна маса — 92 670[4].

Послідовність амінокислот
1020304050
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNV
SSHLDKASVMRLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFV
MVLTDDGDMIYISDNVNKYMGLTQFELTGHSVFDFTHPCDHEEMREMLTH
RNGLVKKGKEQNTQRSFFLRMKCTLTSRGRTMNIKSATWKVLHCTGHIHV
YDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSKTFLSRHSLDM
KFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDL
IFSLQQTECVLKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLL
APAAGDTIISLDFGSNDTETDDQQLEEVPLYNDVMLPSPNEKLQNINLAM
SPLPTAETPKPLRSSADPALNQEVALKLEPNPESLELSFTMPQIQDQTPS
PSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLFAEDTEAKNPF
STQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKE
TTSATSSPYRDTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTT
VPEEELNPKILALQNAQRKRKMEHDGSLFQAVGIGTLLQQPDDHAATTSL
SWKRVKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDC
EVNAPIQGSRNLLQGEELLRALDQVN

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Є основним фактором, індукованим гіпоксією[en].

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Wang G.L., Jiang B.-H., Rue E.A., Semenza G.L. (1995). Hypoxia-inducible factor 1 is a basic-helix-loop-helix-PAS heterodimer regulated by cellular O2 tension.. Proc. Natl. Acad. Sci. U.S.A. 92: 5510 — 5514.  PubMed DOI:10.1073/pnas.92.12.5510
  • Iyer N.V., Leung S.W., Semenza G.L. (1998). The human hypoxia-inducible factor 1alpha gene: HIF1A structure and evolutionary conservation.. Genomics 52: 159 — 165.  PubMed DOI:10.1006/geno.1998.5416
  • Lukashev D., Sitkovsky M. (2008). Preferential expression of the novel alternative isoform I.3 of hypoxia-inducible factor 1alpha in activated human T lymphocytes.. Hum. Immunol. 69: 421 — 425.  PubMed DOI:10.1016/j.humimm.2008.05.004
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Jiang B.H., Zheng J.Z., Leung S.W., Roe R., Semenza G.L. (1997). Transactivation and inhibitory domains of hypoxia-inducible factor 1alpha. Modulation of transcriptional activity by oxygen tension.. J. Biol. Chem. 272: 19253 — 19260.  PubMed DOI:10.1074/jbc.272.31.19253
  • Huang L.E., Gu J., Schau M., Bunn H.F. (1998). Regulation of hypoxia-inducible factor 1alpha is mediated by an O2-dependent degradation domain via the ubiquitin-proteasome pathway.. Proc. Natl. Acad. Sci. U.S.A. 95: 7987 — 7992.  PubMed DOI:10.1073/pnas.95.14.7987

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4910 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q16665 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]