NFATC4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFATC4
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFATC4, NF-AT3, NF-ATC4, NFAT3, nuclear factor of activated T-cells 4, nuclear factor of activated T cells 4
Зовнішні ІД OMIM: 602699 MGI: 1920431 HomoloGene: 3349 GeneCards: NFATC4
Шаблон експресії
PBB GE NFATC4 213345 at fs.png

PBB GE NFATC4 205897 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001168346
NM_023699
RefSeq (білок)
NP_001161818
NP_076188
Локус (UCSC) Хр. 14: 24.37 – 24.38 Mb Хр. 14: 55.82 – 55.83 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFATC4 (англ. Nuclear factor of activated T-cells 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 902 амінокислот, а молекулярна маса — 95 449[4].

Послідовність амінокислот
1020304050
MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGE
PPPYGAAPIGIPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGG
GAGGAGGGRVLECPSIRITSISPTPEPPAALEDNPDAWGDGSPRDYPPPE
GFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDASDEAALYAACDEVES
ELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGGRGPEDSWLLL
SAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASC
NGKLPLGAEESVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRT
SALPPLDWPLPSQYEQLELRIEVQPRAHHRAHYETEGSRGAVKAAPGGHP
VVKLLGYSEKPLTLQMFIGTADERNLRPHAFYQVHRITGKMVATASYEAV
VSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRV
RLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV
PEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRG
FPSASATPFGTDMDFSPPRPPYPSYPHEDPACETPYLSEGFGYGMPPLYP
QTGPPPSYRPGLRMFPETRGTTGCAQPPAVSFLPRPFPSDPYGGRGSSFS
LGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGYNKVGPGYGPG
EGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEP
PA

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Hoey T., Sun Y.-L., Williamson K., Xu X. (1995). Isolation of two new members of the NF-AT gene family and functional characterization of the NF-AT proteins.. Immunity 2: 461 — 472.  PubMed DOI:10.1016/1074-7613(95)90027-6
  • Vihma H., Pruunsild P., Timmusk T. (2008). Alternative splicing and expression of human and mouse NFAT genes.. Genomics 92: 279 — 291.  PubMed DOI:10.1016/j.ygeno.2008.06.011
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Crabtree G.R. (1999). Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT.. Cell 96: 611 — 614.  PubMed DOI:10.1016/S0092-8674(00)80571-1
  • Yang T.T.C., Davis R.J., Chow C.-W. (2001). Requirement of two NFATc4 transactivation domains for CBP potentiation.. J. Biol. Chem. 276: 39569 — 39576.  PubMed DOI:10.1074/jbc.M102961200
  • Yang T.T.C., Xiong Q., Enslen H., Davis R.J., Chow C.-W. (2002). Phosphorylation of NFATc4 by p38 mitogen-activated protein kinases.. Mol. Cell. Biol. 22: 3892 — 3904.  PubMed DOI:10.1128/MCB.22.11.3892-3904.2002

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7778 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q14934 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]