STAT5A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
STAT5A
Protein STAT5A PDB 1y1u.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи STAT5A, MGF, STAT5, signal transducer and activator of transcription 5A
Зовнішні ІД OMIM: 601511 MGI: 103036 HomoloGene: 20680 GeneCards: STAT5A
Шаблон експресії
PBB GE STAT5A 203010 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001288718
NM_001288719
NM_001288720
NM_003152
NM_001164062
NM_011488
NM_001362680
RefSeq (білок)
NP_001275647
NP_001275648
NP_001275649
NP_003143
NP_001157534
NP_035618
NP_001349609
Локус (UCSC) Хр. 17: 42.29 – 42.31 Mb Хр. 11: 100.86 – 100.89 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STAT5A (англ. Signal transducer and activator of transcription 5A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 794 амінокислот, а молекулярна маса — 90 647[4].

Послідовність амінокислот
1020304050
MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDN
PQDRAQATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQKTYDR
CPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQKHLQINQTFEE
LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSR
ETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDD
ELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNC
CVMEYHQATGTLSAHFRNMSLKRIKRADRRGAESVTEEKFTVLFESQFSV
GSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPD
KVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSG
LSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRD
FSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIK
QVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDG
EFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Hou J., Schindler U., Henzel W.J., Wong S.C., McKnight S.L. (1995). Identification and purification of human Stat proteins activated in response to interleukin-2.. Immunity 2: 321 — 329.  PubMed DOI:10.1016/1074-7613(95)90140-X
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Aoki N., Matsuda T. (2002). A nuclear protein tyrosine phosphatase TC-PTP is a potential negative regulator of the PRL-mediated signaling pathway: dephosphorylation and deactivation of signal transducer and activator of transcription 5a and 5b by TC-PTP in nucleus.. Mol. Endocrinol. 16: 58 — 69.  PubMed DOI:10.1210/mend.16.1.0761
  • Litterst C.M., Kliem S., Marilley D., Pfitzner E. (2003). NCoA-1/SRC-1 is an essential coactivator of STAT5 that binds to the FDL motif in the alpha-helical region of the STAT5 transactivation domain.. J. Biol. Chem. 278: 45340 — 45351.  PubMed DOI:10.1074/jbc.M303644200
  • Benitah S.A., Valeron P.F., Rui H., Lacal J.C. (2003). STAT5a activation mediates the epithelial to mesenchymal transition induced by oncogenic RhoA.. Mol. Biol. Cell 14: 40 — 53.  PubMed DOI:10.1091/mbc.E02-08-0454
  • Ronnstrand L. (2004). Signal transduction via the stem cell factor receptor/c-Kit.. Cell. Mol. Life Sci. 61: 2535 — 2548.  PubMed DOI:10.1007/s00018-004-4189-6

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11366 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P42229 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]