FOXA3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXA3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FOXA3, FKHH3, HNF3G, TCF3G, forkhead box A3
Зовнішні ІД OMIM: 602295 MGI: 1347477 HomoloGene: 3308 GeneCards: FOXA3
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004497
NM_008260
RefSeq (білок)
NP_004488
NP_032286
Локус (UCSC) Хр. 19: 45.86 – 45.87 Mb Хр. 7: 19.01 – 19.02 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXA3 (англ. Forkhead box A3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 350 амінокислот, а молекулярна маса — 37 140[4].

Послідовність амінокислот
1020304050
MLGSVKMEAHDLAEWSYYPEAGEVYSPVTPVPTMAPLNSYMTLNPLSSPY
PPGGLPASPLPSGPLAPPAPAAPLGPTFPGLGVSGGSSSSGYGAPGPGLV
HGKEMPKGYRRPLAHAKPPYSYISLITMAIQQAPGKMLTLSEIYQWIMDL
FPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWALHPSSGNM
FENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSP
PQPPPPAPEPEAQGGEDVGALDCGSPASSTPYFTGLELPGELKLDAPYNF
NHPFSINNLMSEQTPAPPKLDVGFGGYGAEGGEPGVYYQGLYSRSLLNAS

Кодований геном білок за функціями належить до активаторів, регуляторів хроматину, білків розвитку. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, сперматогенез. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lin B., Morris D.W., Chou J.Y. (1997). The role of HNF1alpha, HNF3gamma, and cyclic AMP in glucose-6-phosphatase gene activation.. Biochemistry 36: 14096 — 14106.  PubMed DOI:10.1021/bi9703249
  • Riffel A.K., Schuenemann E., Vyhlidal C.A. (2009). Regulation of the CYP3A4 and CYP3A7 promoters by members of the nuclear factor I transcription factor family.. Mol. Pharmacol. 76: 1104 — 1114.  PubMed DOI:10.1124/mol.109.055699
  • Clark K.L., Halay E.D., Lai E., Burley S.K. (1993). Co-crystal structure of the HNF-3/fork head DNA-recognition motif resembles histone H5.. Nature 364: 412 — 420.  PubMed DOI:10.1038/364412a0
  • Hromas R., Moore J., Johnston T., Socha C., Klemsz M. (1993). Drosophila forkhead homologues are expressed in a lineage-restricted manner in human hematopoietic cells.. Blood 81: 2854 — 2859.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5023 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P55318 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]