ZNF593

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF593
Protein ZNF593 PDB 1zr9.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ZNF593, ZT86, zinc finger protein 593
Зовнішні ІД OMIM: 616698 MGI: 1915290 HomoloGene: 41070 GeneCards: ZNF593
Шаблон експресії
PBB GE ZNF593 204175 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_015871
NM_024215
RefSeq (білок)
NP_056955
NP_077177
Локус (UCSC) Хр. 1: 26.17 – 26.17 Mb Хр. 4: 134.24 – 134.25 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF593 (англ. Zinc finger protein 593) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 134 амінокислот, а молекулярна маса — 15 199[4].

Послідовність амінокислот
1020304050
MGRSRRTGAHRAHSLARQMKAKRRRPDLDEIHRELRPQGSARPQPDPNAE
FDPDLPGGGLHRCLACARYFIDSTNLKTHFRSKDHKKRLKQLSVEPYSQE
EAERAAGMGSYVPPRRLAVPTEVSTEVPEMDTST

Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Terunuma A., Shiba K., Noda T. (1997). A novel genetic system to isolate a dominant negative effector on DNA-binding activity of Oct-2.. Nucleic Acids Res. 25: 1984 — 1990.  PubMed DOI:10.1093/nar/25.10.1984
  • Hayes P.L., Lytle B.L., Volkman B.F., Peterson F.C. (2008). The solution structure of ZNF593 from Homo sapiens reveals a zinc finger in a predominantly unstructured protein.. Protein Sci. 17: 571 — 576.  PubMed DOI:10.1110/ps.073290408

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:30943 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, O00488 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]