ZNF366

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF366
Ідентифікатори
Символи ZNF366, DCSCRIPT, zinc finger protein 366, DC-SCRIPT
Зовнішні ІД OMIM: 610159 MGI: 2178429 HomoloGene: 17637 GeneCards: ZNF366
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_152625
NM_001004149
RefSeq (білок)
NP_689838
NP_001004149
Локус (UCSC) Хр. 5: 72.44 – 72.51 Mb Хр. 13: 99.18 – 99.25 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF366 (англ. Zinc finger protein 366) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 744 амінокислот, а молекулярна маса — 85 107[4].

Послідовність амінокислот
1020304050
MQKEMKMIKDEDVHFDLAVKKTPSFPHCLQPVASRGKAPQRHPFPEALRG
PFSQFRYEPPPGDLDGFPGVFEGAGSRKRKSMPTKMPYNHPAEEVTLALH
SEENKNHGLPNLPLLFPQPPRPKYDSQMIDLCNVGFQFYRSLEHFGGKPV
KQEPIKPSAVWPQPTPTPFLPTPYPYYPKVHPGLMFPFFVPSSSPFPFSR
HTFLPKQPPEPLLPRKAEPQESEETKQKVERVDVNVQIDDSYYVDVGGSQ
KRWQCPTCEKSYTSKYNLVTHILGHSGIKPHACTHCGKLFKQLSHLHTHM
LTHQGTRPHKCQVCHKAFTQTSHLKRHMMQHSEVKPHNCRVCGRGFAYPS
ELKAHEAKHASGRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCSECDK
TFQYPSQLQNHMMKHKDIRPYICSECGMEFVQPHHLKQHSLTHKGVKEHK
CGICGREFTLLANMKRHVLIHTNIRAYQCHLCYKSFVQKQTLKAHMIVHS
DVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPSKFTLKGNLTR
HMKVKHGVMERGLHSQGLGRGRIALAQTAGVLRSLEQEEPFDLSQKRRAK
VPVFQSDGESAQGSHCHEEEEEDNCYEVEPYSPGLAPQSQQLCTPEDLST
KSEHAPEVLEEACKEEKEDASKGEWEKRSKGDLGAEGGQERDCAGRDECL
SLRAFQSTRRGPSFSDYLYFKHRDESLKELLERKMEKQAVLLGI

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Gilligan P., Brenner S., Venkatesh B. (2002). Fugu and human sequence comparison identifies novel human genes and conserved non-coding sequences.. Gene 294: 35 — 44.  PubMed DOI:10.1016/S0378-1119(02)00793-X

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:18316 (англ.). Процитовано 5 вересня 2017. 
  4. UniProt, Q8N895 (англ.). Процитовано 5 вересня 2017. 

Див. також[ред. | ред. код]