ZNF649

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF649
Ідентифікатори
Символи ZNF649, zinc finger protein 649
Зовнішні ІД OMIM: 611903 HomoloGene: 56964 GeneCards: ZNF649
Шаблон експресії
PBB GE ZNF649 gnf1h00417 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_023074
н/д
RefSeq (білок)
NP_075562
н/д
Локус (UCSC) Хр. 19: 51.89 – 51.91 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF649 (англ. Zinc finger protein 649) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 505 амінокислот, а молекулярна маса — 57 683[3].

Послідовність амінокислот
1020304050
MTKAQESLTLEDVAVDFTWEEWQFLSPAQKDLYRDVMLENYSNLVSVGYQ
AGKPDALTKLEQGEPLWTLEDEIHSPAHPEIEKADDHLQQPLQNQKILKR
TGQRYEHGRTLKSYLGLTNQSRRYNRKEPAEFNGDGAFLHDNHEQMPTEI
EFPESRKPISTKSQFLKHQQTHNIEKAHECTDCGKAFLKKSQLTEHKRIH
TGKKPHVCSLCGKAFYKKYRLTEHERAHRGEKPHGCSLCGKAFYKRYRLT
EHERAHKGEKPYGCSECGKAFPRKSELTEHQRIHTGIKPHQCSECGRAFS
RKSLLVVHQRTHTGEKPHTCSECGKGFIQKGNLNIHQRTHTGEKPYGCID
CGKAFSQKSCLVAHQRYHTGKTPFVCPECGQPCSQKSGLIRHQKIHSGEK
PYKCSDCGKAFLTKTMLIVHHRTHTGERPYGCDECEKAYFYMSCLVKHKR
IHSREKRGDSVKVENPSTASHSLSPSEHVQGKSPVNMVTVAMVAGQCEFA
HILHS

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:25741 (англ.). Процитовано 12 вересня 2017. 
  3. UniProt, Q9BS31 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]