BCL10

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
BCL10
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи BCL10, CARMEN, CIPER, CLAP, c-E10, mE10, IMD37, B-cell CLL/lymphoma 10, B cell CLL/lymphoma 10, immune signaling adaptor, BCL10 immune signaling adaptor
Зовнішні ІД OMIM: 603517 MGI: 1337994 HomoloGene: 2912 GeneCards: BCL10
Пов'язані генетичні захворювання
MALT lymphoma[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003921
NM_001320715
NM_009740
RefSeq (білок)
NP_001307644
NP_003912
NP_001307644.1
NP_033870
Локус (UCSC) Хр. 1: 85.27 – 85.28 Mb Хр. 3: 145.92 – 145.93 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

BCL10 (англ. B-cell CLL/lymphoma 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 233 амінокислот, а молекулярна маса — 26 252[5].

Послідовність амінокислот
1020304050
MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSRE
DTEEISCRTSSRKRAGKLLDYLQENPKGLDTLVESIRREKTQNFLIQKIT
DEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDESNFSEKLRAS
TVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGA
PPLPPDLQLEEEGTCANSSEMFLPLRSRTVSRQ

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як апоптоз, імунітет, ацетиляція. Локалізований у цитоплазмі, мембрані.

Література[ред. | ред. код]

  • Yan M., Lee J., Schilbach S., Goddard A., Dixit V.M. (1999). mE10, a novel caspase recruitment domain-containing proapoptotic molecule.. J. Biol. Chem. 274: 10287 — 10292.  PubMed DOI:10.1074/jbc.274.15.10287
  • Costanzo A., Guiet C., Vito P. (1999). c-E10 is a caspase-recruiting domain-containing protein that interacts with components of death receptors signaling pathway and activates nuclear factor-kappaB.. J. Biol. Chem. 274: 20127 — 20132.  PubMed DOI:10.1074/jbc.274.29.20127
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lobry C., Lopez T., Israel A., Weil R. (2007). Negative feedback loop in T cell activation through IkappaB kinase-induced phosphorylation and degradation of Bcl10.. Proc. Natl. Acad. Sci. U.S.A. 104: 908 — 913.  PubMed DOI:10.1073/pnas.0606982104
  • Apostolou S., de Rienzo A., Murthy S.S., Jhanwar S.C., Testa J.R. (1999). Absence of BCL10 mutations in human malignant mesothelioma.. Cell 97: 684 — 686.  PubMed DOI:10.1016/S0092-8674(02)09765-9

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]