ZNF3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF3
Ідентифікатори
Символи ZNF3, A8-51, HF.12, KOX25, PP838, Zfp113, zinc finger protein 3
Зовнішні ІД OMIM: 194510 MGI: 1929116 HomoloGene: 50027 GeneCards: ZNF3
Шаблон експресії
PBB GE ZNF3 219604 s at fs.png

PBB GE ZNF3 219605 at fs.png

PBB GE ZNF3 212684 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_019747
RefSeq (білок)
н/д
Локус (UCSC) Хр. 7: 100.06 – 100.08 Mb Хр. 5: 138.14 – 138.16 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF3 (англ. Zinc finger protein 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 446 амінокислот, а молекулярна маса — 50 916[4].

Послідовність амінокислот
1020304050
METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQEL
VTFEDVAVYFIRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQ
EISEDTRSHGVLLGRFQKDISQGLKFKEAYEREVSLKRPLGNSPGERLNR
KMPDFGQVTVEEKLTPRGERSEKYNDFGNSFTVNSNLISHQRLPVGDRPH
KCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQSSHLIQHQRIH
TGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLT
HHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFS
QSSHLYQHQRIHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSE
CGKAFRYSSALVRHQRIHTGEKPLNGIGMSKSSLRVTTELNIREST

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, диференціація клітин, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rosati M., Marino M., Franze A., Tramontano A., Grimaldi G. (1991). Members of the zinc finger protein gene family sharing a conserved N-terminal module.. Nucleic Acids Res. 19: 5661 — 5667.  PubMed DOI:10.1093/nar/19.20.5661
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033
  • Thiesen H.-J. (1990). Multiple genes encoding zinc finger domains are expressed in human T cells.. New Biol. 2: 363 — 374.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13089 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, P17036 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]