GTF2F1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
GTF2F1
Protein GTF2F1 PDB 1f3u.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи GTF2F1, general transcription factor IIF, polypeptide 1, 74kDa, BTF4, RAP74, TF2F1, TFIIF, general transcription factor IIF subunit 1
Зовнішні ІД OMIM: 189968 MGI: 1923848 HomoloGene: 1585 GeneCards: GTF2F1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002096
NM_133801
RefSeq (білок)
NP_002087
NP_598562
Локус (UCSC) Хр. 19: 6.38 – 6.39 Mb Хр. 17: 57 – 57.01 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

GTF2F1 (англ. General transcription factor IIF subunit 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 517 амінокислот, а молекулярна маса — 58 240[4].

Послідовність амінокислот
1020304050
MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERD
LSNKKIYQEEEMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLL
RVNGKSGRKFKGIKKGGVTENTSYYIFTQCPDGAFEAFPVHNWYNFTPLA
RHRTLTAEEAEEEWERRNKVLNHFSIMQQRRLKDQDQDEDEEEKEKRGRR
KASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPLAKGGRKKKKK
KGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKG
VDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEE
SDIDSEASSALFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSST
LRAAASKLEQGKRVSEMPAAKRLRLDTGPQSLSGKSTPQPPSGKTTPNSG
DVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQILKRL
NPERKMINDKMHFSLKE

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dikstein R., Ruppert S., Tjian R. (1996). TAFII250 is a bipartite protein kinase that phosphorylates the base transcription factor RAP74.. Cell 84: 781 — 790.  PubMed DOI:10.1016/S0092-8674(00)81055-7
  • Rossignol M., Keriel A., Staub A., Egly J.-M. (1999). Kinase activity and phosphorylation of the largest subunit of TFIIF transcription factor.. J. Biol. Chem. 274: 22387 — 22392.  PubMed DOI:10.1074/jbc.274.32.22387
  • Leong W.F., Chow V.T. (2006). Transcriptomic and proteomic analyses of rhabdomyosarcoma cells reveal differential cellular gene expression in response to enterovirus 71 infection.. Cell. Microbiol. 8: 565 — 580.  PubMed DOI:10.1111/j.1462-5822.2005.00644.x
  • Beausoleil S.A., Villen J., Gerber S.A., Rush J., Gygi S.P. (2006). A probability-based approach for high-throughput protein phosphorylation analysis and site localization.. Nat. Biotechnol. 24: 1285 — 1292.  PubMed DOI:10.1038/nbt1240
  • Gaiser F., Tan S., Richmond T.J. (2000). Novel dimerization fold of RAP30/RAP74 in human TFIIF at 1.7 A resolution.. J. Mol. Biol. 302: 1119 — 1127.  PubMed DOI:10.1006/jmbi.2000.4110

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4652 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P35269 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]